Recombinant Xenopus laevis Transmembrane protein 18 (tmem18)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Transmembrane Protein 18 (TMEM18)

Xenopus laevis Transmembrane protein 18 (TMEM18) is a protein associated with diverse biological functions, including obesity and centromeric chromatin assembly . TMEM18 has been identified as a gene that influences body mass index (BMI) and is expressed in various hypothalamic regions, which are involved in appetite and energy expenditure . In Xenopus laevis, TMEM18 is involved in the assembly of centromeric chromatin by binding to CENP-A nucleosomes .

TMEM18 and Body Mass Index (BMI)

Genetic studies have repeatedly shown a strong association between the TMEM18 region on human chromosome 2 and increased BMI in adults and children .

TMEM18 Sequence Variation and BMI

FeatureDescription
Sample3976 individuals of European ancestry from three community-based cohorts (ARIC, CHS, and FHS)
Variants Analyzed2,180 variants in or near TMEM18, including 1,629 novel variants
Minor Allele FrequenciesRanging from 0.0002 to 0.49
Common Variants288 variants
Location of VariantsThe majority were intergenic; 405 variants (35 common) were located in transcription factor binding regions assayed by ChIP-seq
Independent SNPs Associated to BMI43 nominally significant SNPs (p<0.05), 8 of them in regulatory regions

Role of TMEM18 in Central Control of Body Weight

Research indicates that altering TMEM18 expression in mice can affect body weight . Male mice with a germline loss of Tmem18 exhibit increased body weight due to significant increases in fat and lean mass, particularly when fed a high-fat diet (HFD) . Overexpression of Tmem18 in the hypothalamic paraventricular nucleus (PVN) can reduce food intake, increase energy expenditure, and reduce total body and fat mass .

TMEM18 and Centromeric Chromatin Assembly

In Xenopus laevis, M18BP1, which is related to TMEM18, directly binds to existing CENP-A nucleosomes to promote centromeric chromatin assembly . Vertebrate centromeres are epigenetically defined by nucleosomes containing the histone H3 variant, CENP-A, and the Mis18 complex (Mis18α, Mis18β, and M18BP1) recruits the CENP-A chaperone HJURP to centromeres to facilitate CENP-A nucleosome assembly .

M18BP1 Binding to CENP-A Nucleosomes

FeatureDescription
OrganismXenopus laevis
M18BP1 IsoformsM18BP1-1 and M18BP1-2 (74% sequence identity)
Binding AffinityM18BP1-1 was 2.5-fold enriched on CENP-A chromatin relative to H3 chromatin; M18BP1-2 was 5-fold enriched on CENP-A chromatin relative to H3 chromatin
Cell Cycle RegulationM18BP1 binding to CENP-A nucleosomes is cell cycle regulated; transitions from a CENP-C-dependent mechanism in metaphase to a CENP-C-independent mechanism in interphase
CENP-A Assembly RequirementM18BP1 must bind CENP-A nucleosomes to promote new CENP-A assembly; mutants defective in CENP-A nucleosome binding show reduced Myc-CENP-A assembly at sperm centromeres

Expression and Regulation of TMEM18

TMEM18 is highly expressed within the hypothalamus and nutritionally regulated . Studies show that TMEM18 is expressed in several hypothalamic regions, with nutritional regulation observed in the PVN . The character of TMEM18-expressing neurons within the PVN remains to be determined .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
tmem18; Transmembrane protein 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem18
Target Protein Sequence
MAEEPGVWSLLERAPIDWTEPWLIGLAAFHILCFIVTYISFKSYPLQICHFLLMVVLVSC AEYINEFAAMHWRAYSKQQYFDSSGMFISLAFSAPLLCNTIIIVVHWVYKTLCVMTELKT LQQKRKESREKRKKKE
Uniprot No.

Target Background

Database Links

KEGG: xla:735124

UniGene: Xl.52391

Protein Families
TMEM18 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.

Q&A

What makes Xenopus laevis a suitable model organism for studying transmembrane proteins like tmem18?

Xenopus laevis offers several distinct advantages for transmembrane protein research. This amphibian model presents an external developmental environment free from maternal influence, allowing easy experimental access from early developmental stages. Its immune system remarkably parallels mammalian systems while providing unique comparative insights . For transmembrane protein studies specifically, Xenopus offers large cells with robust expression systems, making it ideal for protein localization and functional characterization experiments. Additionally, the availability of large-scale genetic and genomic resources supports comprehensive investigation of transmembrane proteins in an evolutionarily significant vertebrate model .

How does tmem18 expression differ between tadpole and adult Xenopus laevis?

The expression patterns of transmembrane proteins, including tmem18, undergo significant changes during Xenopus metamorphosis. This transition coincides with dramatic physiological changes, including reorganization of the immune system and MHC gene expression . During metamorphosis, new T-cell differentiation occurs in the thymus, which can affect the expression and function of various transmembrane proteins. Researchers can exploit this developmentally regulated expression by using experimental manipulations such as thymectomy or controlling metamorphosis timing to study developmental regulation of tmem18 in different life stages .

What are the fundamental techniques for isolating recombinant tmem18 from Xenopus laevis?

The isolation of recombinant tmem18 from Xenopus requires a multi-step approach:

  • Gene cloning and vector construction: The tmem18 gene must first be PCR-amplified from Xenopus cDNA and cloned into appropriate expression vectors.

  • Expression system selection: For transmembrane proteins, researchers can use:

    • Cell-free Xenopus oocyte translation systems

    • Xenopus oocyte microinjection for expression

    • Transgenic approaches in tadpoles or adults

  • Protein extraction and purification: Transmembrane proteins require specialized detergent-based extraction protocols, followed by affinity chromatography using epitope tags.

  • Verification methods: Successful isolation should be confirmed using Western blotting with antibodies specific to tmem18 or attached epitope tags, and mass spectrometry for protein identification.

What genetic tools are available for studying tmem18 expression in Xenopus laevis?

Multiple genetic manipulation techniques have been developed for Xenopus research that can be applied to tmem18 studies:

  • Viral vectors: Vesicular stomatitis virus (VSV) serves as a quick and effective vector for delivering transgenes in adult Xenopus neurons, showing robust expression within days of infection . This approach allows for rapid tmem18 overexpression or reporter gene fusion studies.

  • RNAi-mediated loss of function: Transgenic approaches using I-SceI meganuclease enable targeted knockdown of tmem18 expression .

  • Electroporation: While highly effective in tadpole neurons, this technique shows limited efficiency in adult Xenopus neurons .

  • Transgenic technology: Permanent genetic modifications can be achieved through transgenic approaches, as exemplified by GFP-expressing Xenopus models .

How does tmem18 protein structure compare between Xenopus laevis and mammalian models?

Transmembrane proteins in Xenopus laevis often share structural conservation with mammalian counterparts while exhibiting species-specific adaptations. For tmem18 specifically, researchers should note:

  • Domain conservation: The core transmembrane domains typically show high sequence homology across vertebrates.

  • Species-specific modifications: Xenopus tmem18 may contain unique post-translational modification sites adapted to amphibian physiology.

  • Functional implications: These structural differences can provide valuable insights into evolutionary adaptation of membrane protein function across vertebrate lineages.

  • Model advantages: The Xenopus system allows for structure-function studies in a comparative framework that bridges evolutionary distance between non-mammalian and mammalian systems .

What are the optimal viral vector systems for overexpressing recombinant tmem18 in Xenopus laevis neurons?

Based on systematic evaluations of viral vector performance in adult Xenopus neurons, the following hierarchical recommendation emerges:

  • Vesicular stomatitis virus (VSV): Demonstrates superior performance with fast and robust transgene expression in Xenopus neurons. VSV-infected neurons maintain normal physiological properties for up to 7 days post-infection, providing an excellent window for tmem18 functional studies .

  • Adeno-associated virus (AAV): Shows inconsistent results in Xenopus neurons, with variable transduction efficiency .

  • Lentivirus (LV): Generally ineffective as a viral vector in adult Xenopus neurons .

Key considerations for VSV-based tmem18 expression:

  • VSV does not enter myelinated axons but is taken up by both soma and axon terminals

  • Insert size limitations may require optimization for large constructs

  • Expression peaks at 2-7 days post-infection, ideal for acute functional studies

How can electrophysiological approaches be integrated with tmem18 expression studies in Xenopus?

Electrophysiological characterization of tmem18-expressing neurons requires specialized approaches:

  • Whole-cell patch-clamp recordings: Can be performed on VSV-transduced neurons expressing tmem18 or reporter constructs. Studies show that neurons maintain normal resting membrane potential (-41.30 ± 1.98 mV for labeled vs. -49.67 ± 1.93 mV for unlabeled neurons) and input resistance (1.42 ± 0.74 GΩ vs. 1.61 ± 0.43 GΩ) for up to 7 days post-infection .

  • Combined optogenetic and electrophysiological approaches: For functional studies, channelrhodopsin can be co-expressed with tmem18 to allow light-controlled activation while monitoring electrophysiological parameters.

  • Ex vivo preparations: The unique ability to maintain isolated Xenopus brains allows for extended ex vivo recordings from tmem18-manipulated circuits .

What approaches can resolve the subcellular localization of tmem18 in different Xenopus tissues?

Multi-modal imaging techniques provide comprehensive insights into tmem18 subcellular distribution:

  • Fluorescent fusion proteins: Creating tmem18-GFP fusions with VSV delivery allows visualization in live neurons with maintained physiological function .

  • Super-resolution microscopy applications:

    • STORM (Stochastic Optical Reconstruction Microscopy)

    • PALM (Photoactivated Localization Microscopy)
      These techniques can resolve tmem18 localization within membrane microdomains beyond diffraction limits.

  • Electron microscopy with immunogold labeling: Provides nanometer-scale resolution of tmem18 distribution within cellular compartments.

  • Tissue-specific variations: Comparative analysis across neural, immune, and developmental tissues reveals context-dependent localization patterns.

How does metamorphosis affect tmem18 function in Xenopus laevis immune system development?

The dramatic reorganization during Xenopus metamorphosis offers a unique window into developmental regulation of tmem18:

  • Immune system remodeling: During metamorphosis, MHC gene expression patterns change concurrently with new T-cell differentiation in the thymus . This transition period potentially alters tmem18 expression patterns and functional roles.

  • Experimental approaches:

    • Thymectomy at early developmental stages can isolate tmem18 functions in T-cell dependent versus independent contexts

    • Manipulating metamorphosis timing through hormone treatment provides temporal control over tmem18 expression changes

    • Flow cytometry analysis of immune cells during transition periods can track tmem18-expressing populations

  • Self-tolerance mechanisms: The developmental shift in MHC expression during metamorphosis creates a natural model for studying transmembrane protein roles in self-tolerance development .

What are the technical challenges in creating CRISPR/Cas9 knockouts of tmem18 in Xenopus laevis?

Creating precise genetic modifications in Xenopus presents specific challenges:

  • Allotetraploidy complications: Xenopus laevis has a pseudotetraploid genome, requiring modification of multiple tmem18 alleles for complete knockout.

  • Delivery methods optimization:

    • Microinjection into fertilized eggs remains most effective

    • Viral vector delivery of CRISPR components shows variable efficiency

    • Electroporation methods require tadpole-stage application for optimal results

  • Validation strategies:

    • RT-PCR to confirm transcript reduction across all alleles

    • Western blotting with specific antibodies

    • Phenotypic analysis requiring careful developmental monitoring

  • Alternative approaches: For transmembrane proteins like tmem18, dominant-negative constructs delivered by VSV often provide faster results than complete knockouts .

How can recombinant tmem18 be utilized in immunological studies in Xenopus laevis?

Xenopus offers unique immunological applications for tmem18 research:

  • Comparative immunity model: Xenopus provides valuable insights into evolutionary adaptations of immune-related transmembrane proteins like tmem18 across vertebrate lineages .

  • Skin graft assays: Utilizing MHC-defined inbred strains, researchers can assess how tmem18 expression affects immune recognition and tolerance through skin grafting protocols .

  • Tumor immunity applications: Thymic lymphoid tumor lines can be engineered to express modified tmem18 variants, then transplanted into compatible MHC-defined inbred strains to study immune responses .

  • ELISA-based antibody response analysis: Quantitative assessment of antibody responses against tmem18 or associated antigens can be performed using established protocols .

  • Flow cytometric analysis: Standardized protocols allow quantification of tmem18-expressing immune cell populations .

What are the most reliable methods for quantifying tmem18 expression levels in Xenopus tissues?

Multiple complementary approaches ensure reliable tmem18 quantification:

MethodSensitivityAdvantagesLimitations
qRT-PCRHighQuantifies transcript levels across tissues; requires small sample amountsDoes not detect post-transcriptional regulation
Western BlottingMediumDirectly measures protein levels; detects post-translational modificationsRequires specific antibodies; less quantitative than PCR
Flow CytometryMedium-HighSingle-cell resolution; can sort tmem18-positive populationsRequires cell dissociation; limited to accessible tissues
Mass SpectrometryVery HighAbsolute quantification; identifies protein variantsExpensive; complex sample preparation
RNA-SeqVery HighGenome-wide context; identifies splice variantsComplex data analysis; indirect protein measure

For transmembrane proteins like tmem18, membrane fraction isolation before analysis significantly improves detection sensitivity.

How does tmem18 function compare between Xenopus laevis and Xenopus tropicalis models?

Comparing tmem18 across Xenopus species yields important evolutionary and functional insights:

  • Genomic considerations:

    • X. laevis: Allotetraploid genome with potential tmem18 gene duplications

    • X. tropicalis: Diploid genome with simpler genetic architecture

  • Cross-species reagent utility: Some monoclonal antibodies developed for X. laevis, including those targeting immune-related molecules, cross-react with X. tropicalis proteins . This potentially extends to tmem18-specific reagents.

  • Functional conservation: Information obtained about tmem18 gene expression and loss-of-function in X. laevis can often be transposed to X. tropicalis due to their evolutionary relationship .

  • Model-specific advantages:

    • X. tropicalis: Faster generation time benefits genetic studies

    • X. laevis: Larger size facilitates certain biochemical and physiological assays

What experimental designs best assess tmem18 involvement in neural development of Xenopus laevis?

Multi-stage approaches capture developmental dynamics of tmem18 function:

  • Neural circuit analysis: The central vocal pathway of Xenopus laevis serves as an excellent model system for studying pattern generation . VSV-mediated expression of tmem18 variants in this pathway allows assessment of transmembrane protein impacts on circuit development.

  • Ex vivo brain preparations: The ability to maintain isolated Xenopus brains for extended periods enables monitoring of tmem18-manipulated circuits over developmental time .

  • Stage-specific manipulations:

    • Targeted VSV injections at different developmental timepoints

    • Hormone-controlled metamorphosis acceleration or delay

    • Stage-specific gene knockdown using RNAi approaches

  • Electrophysiological readouts: Whole-cell patch-clamp recordings from tmem18-expressing neurons provide functional assessment of developmental impacts .

How can protein-protein interaction studies identify binding partners of tmem18 in Xenopus?

Multiple complementary approaches reveal tmem18 interaction networks:

  • Co-immunoprecipitation with mass spectrometry:

    • Express epitope-tagged tmem18 in Xenopus cells or tissues

    • Immunoprecipitate using tag-specific antibodies

    • Identify binding partners through LC-MS/MS analysis

  • Proximity labeling approaches:

    • Fuse tmem18 with BioID or APEX2 enzymes

    • Express fusion constructs in Xenopus using VSV delivery

    • Identify proximal proteins through biotinylation patterns

  • Yeast two-hybrid screening:

    • Use tmem18 cytoplasmic domains as bait

    • Screen against Xenopus cDNA libraries

    • Validate hits in Xenopus cellular contexts

  • Split-fluorescent protein complementation:

    • Fuse tmem18 and candidate interactors with complementary fragments

    • Express in Xenopus neurons or oocytes

    • Visualize interactions through reconstituted fluorescence

What are the common challenges in achieving stable expression of recombinant tmem18 in Xenopus models?

Several technical hurdles require specific solutions:

  • Protein misfolding and aggregation:

    • Optimize codon usage for Xenopus expression

    • Use lower incubation temperatures (16-18°C) to slow folding

    • Include chaperone co-expression constructs

  • Toxicity issues:

    • Use inducible expression systems

    • Employ VSV vectors which maintain normal physiological properties of Xenopus neurons for 7+ days despite infection

    • Titrate expression levels through promoter selection

  • Developmental timing factors:

    • Stage-specific expression patterns require precisely timed interventions

    • For metamorphosis studies, synchronize experimental manipulations with natural developmental transitions

  • Detection limitations:

    • For low-abundance transmembrane proteins, signal amplification methods may be required

    • Consider membrane fractionation before analysis to concentrate tmem18

How can contradictory results in tmem18 functional studies be reconciled across different experimental approaches?

Systematic troubleshooting approaches address experimental inconsistencies:

  • Model system variations:

    • Developmental stage differences significantly impact outcomes

    • Compare results between X. laevis and X. tropicalis when discrepancies arise

    • Account for sex-specific expression patterns

  • Technical approach differences:

    • Viral vector choice impacts expression patterns; VSV shows superior performance over AAV and lentivirus in Xenopus neurons

    • Delivery method (injection site, concentration, volume) standardization is critical

  • Data integration framework:

    • Triangulate findings through multiple complementary methods

    • Consider temporal dynamics in interpretation

    • Develop standardized assays with positive and negative controls

  • Statistical considerations:

    • Account for natural biological variation in Xenopus models

    • Use appropriate statistical tests for non-normally distributed data

    • Implement blinded analysis protocols

What advanced microscopy techniques best visualize tmem18 trafficking in live Xenopus neurons?

Cutting-edge imaging approaches reveal dynamic tmem18 behaviors:

  • Two-photon intravital microscopy: Particularly effective in transparent Xenopus tadpoles, enabling visualization of tmem18 trafficking in intact, functioning neural circuits .

  • Fluorescence recovery after photobleaching (FRAP): Quantifies tmem18 lateral mobility within membranes.

  • Single-particle tracking: With quantum dot-conjugated antibodies against extracellular tmem18 domains.

  • Optogenetic integration:

    • Light-controlled dimerization systems to manipulate tmem18 localization

    • Photo-convertible fluorescent protein fusions to track specific protein populations

  • Correlative light and electron microscopy (CLEM): Combines fluorescence imaging of tmem18-FP fusions with ultrastructural context.

How can RNA-Seq data be effectively analyzed to understand tmem18 regulatory networks in Xenopus?

Systematic bioinformatic approaches reveal regulatory interactions:

  • Differential expression analysis workflow:

    • Compare tmem18 expression across developmental stages

    • Identify co-regulated gene modules

    • Perform GO term and pathway enrichment analysis

  • Alternative splicing assessment:

    • Identify tmem18 splice variants in different tissues

    • Quantify isoform switching during metamorphosis

    • Map tissue-specific expression patterns

  • Integration with ChIP-Seq data:

    • Identify transcription factors binding tmem18 regulatory regions

    • Map enhancer landscapes controlling expression

  • Network inference approaches:

    • Build gene regulatory networks centered on tmem18

    • Identify master regulators controlling expression

    • Validate key interactions through perturbation experiments

What are the emerging applications of optogenetics combined with tmem18 research in Xenopus models?

Innovative optogenetic approaches expand tmem18 research capabilities:

  • Spatiotemporal control of tmem18 function:

    • Fusion with photosensitive protein domains enables light-controlled activity

    • VSV delivers optogenetic constructs with expression window of 7-9 days

    • Integration with ex vivo brain preparation allows precise circuit manipulation

  • Activity-dependent labeling:

    • CaMPARI or similar activity reporters can tag active tmem18-expressing neurons

    • Correlate activity with transmembrane protein function

  • Circuit mapping applications:

    • Express channelrhodopsin in tmem18-positive neurons

    • Map functional connectivity through light-evoked responses

    • Particularly powerful in vocal control circuits of Xenopus

  • Technical considerations:

    • VSV vectors show more reliable expression than AAV for optogenetic applications

    • Expression is maintained with normal neuronal properties for up to 7 days

    • Direct optical access is facilitated by ex vivo preparation capabilities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.