Recombinant Xenopus laevis Transmembrane protein 192 (tmem192)

Shipped with Ice Packs
In Stock

Description

Functional Insights

TMEM192 localizes to lysosomal/late endosomal membranes and influences cellular processes:

Autophagy and Apoptosis Regulation

  • Knockdown Studies: Silencing TMEM192 in HepG2 hepatoma cells activates autophagy (LC3-II conversion) and apoptosis via mitochondrial pathways (Bax upregulation, caspase-3 activation) .

  • Murine Models: TMEM192-deficient mice exhibit normal lysosomal morphology and autophagic flux under basal conditions, suggesting compensatory mechanisms .

Tissue-Specific Expression

  • Ubiquitous Distribution: Highest expression in brain (hippocampus), kidney, spleen, and bone marrow .

  • Processing Specificity: The 17 kDa fragment is absent in liver, indicating tissue-dependent proteolysis .

Research Applications

Recombinant Xenopus laevis TMEM192 is utilized in:

ApplicationExperimental UseSource
Antibody ProductionImmunogen for generating monoclonal antibodies (e.g., clone S02-4J4, S02-3F9) MyBioSource
Protein Interaction StudiesIdentification of binding partners via yeast two-hybrid or co-IP Creative BioMart
Lysosomal Function AssaysAnalysis of lysosomal exocytosis and autophagic flux in knockout models PubMed

Comparative Analysis Across Species

TMEM192 homologs share conserved lysosomal targeting motifs but differ in processing:

SpeciesKey DifferenceFunctional Impact
Human (Q8IY95)No observed 17 kDa fragmentUnclear role in tissue-specific pathways
Mouse (Q9CXT7)17 kDa fragment in most tissues (except liver)Compensatory lysosomal mechanisms
Xenopus laevis (Q66KF2)Full-length recombinant protein used for structural studiesTool for cross-species comparisons

Challenges and Future Directions

  • Unresolved Function: Despite structural insights, TMEM192’s molecular role remains enigmatic .

  • Therapeutic Potential: Links to apoptosis in cancer cells suggest utility in oncology research , though in vivo relevance requires validation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem192; Transmembrane protein 192
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem192
Target Protein Sequence
MERNSRIDSSGDLTQSADEDCFLDAPLLPSQKLQSVIRPHFHPVPTVCISILLALINLAY VTLAVVAFYFCLFSGKKKECNQSVAPFNLSTVLVISKLILWLLHVVNERFAHHHHCKAKN KGFLHLYRSTRHLKGLPLIIHSTGNAALLLILSVQDSISSNRQLYPCLILSVLLLELILS VICLIIYTVRIYRFNKRKPRPDIIEEEKINAYEGHVNPEIGFRHRASLEEVVEKQGDTIE YLKHHNALLSKQLLALTSNQD
Uniprot No.

Target Background

Database Links

KEGG: xla:446304

UniGene: Xl.19528

Protein Families
TMEM192 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Late endosome.

Q&A

How does Xenopus laevis TMEM192 compare with mammalian orthologs?

When comparing Xenopus laevis TMEM192 with mammalian orthologs, several important differences emerge:

FeatureXenopus laevis TMEM192Mouse TMEM192Human TMEM192
Amino acid length261 aa266 aa271 aa
DimerizationUnknownMonomeric under non-reducing conditionsForms homodimers via disulfide bridges
C-terminal cysteineAbsentAbsentPresent (C266)
Subcellular localizationPredicted lysosomalConfirmed lysosomal (co-localizes with LAMP-2)Confirmed lysosomal

A significant difference is the absence of the C-terminal cysteine in Xenopus and mouse TMEM192 that is present in human TMEM192 (position 266). In human cells, this cysteine is involved in forming disulfide bridges between TMEM192 monomers, whereas mouse TMEM192 appears as a monomer even under non-reducing conditions . This structural difference may reflect species-specific functional adaptations.

What expression systems are available for producing recombinant Xenopus laevis TMEM192?

Several expression systems have been successfully used for recombinant TMEM192 production:

Expression SystemAdvantagesLimitationsTag Options
E. coliCost-effective, high yieldMay lack proper folding for transmembrane proteinsHis, GST
Mammalian cells (HEK293)Proper folding and post-translational modificationsHigher cost, lower yieldHis, Fc, various fluorescent tags
Insect cellsGood for membrane proteinsModerate costHis, GST, various fusion tags
YeastCost-effective for eukaryotic expressionMay have different glycosylation patternsHis, various fusion tags

For functional studies, expression in mammalian or insect cells is generally preferred to ensure proper folding and post-translational modifications of the transmembrane protein . For Xenopus laevis TMEM192 specifically, reported recombinant proteins have been produced in various systems including mammalian cells and E. coli .

What techniques are effective for studying TMEM192 subcellular localization in Xenopus cells?

Determining the subcellular localization of TMEM192 in Xenopus cells requires specialized approaches:

  • Immunofluorescence microscopy:

    • Generate specific antibodies against Xenopus TMEM192 (targeting N-terminal epitopes)

    • Co-stain with established lysosomal markers (e.g., LAMP-2)

    • Use super-resolution microscopy for detailed localization studies

  • Fractionation approaches:

    • Perform subcellular fractionation of Xenopus tissues or cells

    • Analyze fractions by Western blotting with TMEM192-specific antibodies

    • Compare distribution with known organelle markers

  • Live cell imaging:

    • Generate fluorescently-tagged TMEM192 constructs (N-terminal tagging recommended)

    • Express in Xenopus cells or embryos via microinjection

    • Co-express with established organelle markers

Based on studies in mouse cells, TMEM192 is expected to localize to lysosomes in Xenopus cells, but this requires experimental verification . When designing tagged constructs, it's important to note that N-terminal epitope tagging has been successfully used for mouse TMEM192 detection .

How can researchers effectively knockdown or knockout TMEM192 in Xenopus laevis experimental systems?

Several approaches are available for functional studies through gene manipulation:

ApproachAdvantagesLimitationsTime Frame
Morpholino oligonucleotidesRapid, dose-adjustable, can target specific splice variantsTransient effect, potential off-target effectsEffects within 24-72 hours
CRISPR/Cas9Permanent modification, complete protein loss possibleMore complex delivery, potential mosaicismRequires F0/F1 screening
Dominant negative constructsCan target specific protein functionsMay have incomplete inhibitionEffects within 24-48 hours after expression
Photo-MOTemporal control of knockdownRequires UV activation, potentially less efficientLight-activated as needed
Vivo-MODirect delivery to tissues without embryo manipulationLimited to accessible tissuesEffects within 24-72 hours

For Xenopus studies, antisense morpholinos have been extensively validated, with options including conventional MO (injected at 4-8 cell stage), photo-inducible MO (activated by 365 nm blue light), and vivo-MO (directly injected into tissue) . The choice depends on experimental requirements, particularly regarding the timing and tissue-specificity of knockdown.

What protein-protein interaction methods are most suitable for identifying TMEM192 binding partners in Xenopus?

To identify TMEM192 interactors in Xenopus:

  • Co-immunoprecipitation approaches:

    • Generate specific antibodies or use tagged TMEM192 constructs

    • Optimize lysis conditions for membrane protein extraction (detergent selection critical)

    • Validate interactions bidirectionally

    • Analyze by mass spectrometry

  • Proximity labeling methods:

    • Fuse TMEM192 with BioID or APEX2

    • Express in Xenopus embryos or cells

    • Identify proximal proteins through streptavidin pulldown and mass spectrometry

  • Yeast two-hybrid adaptations:

    • Use split-ubiquitin system designed for membrane proteins

    • Screen against Xenopus cDNA libraries

  • In vitro binding assays:

    • Express recombinant domains of TMEM192

    • Test direct interactions with candidate partners

Studies in other species have shown that immunoprecipitation of TMEM192 can successfully identify interacting partners. For example, in Xenopus egg extracts, centrosomal protein Cep192 was shown to co-immunoprecipitate with AurA , demonstrating the feasibility of such approaches in Xenopus systems.

How might TMEM192 function in lysosomal biology in Xenopus systems?

Based on mammalian studies, TMEM192 likely functions in lysosomal biology in Xenopus. Experimental approaches to investigate this include:

  • Functional assays after TMEM192 perturbation:

    • Lysosomal pH measurement using ratiometric dyes

    • Lysosomal enzyme activity assays (e.g., cathepsin activity)

    • Autophagy flux monitoring (LC3-II/I ratio, p62 levels)

    • Lysosomal membrane stability assessment

  • Ultrastructural analysis:

    • Transmission electron microscopy of TMEM192-depleted cells

    • Immunogold labeling to localize TMEM192 in lysosomes

    • Morphological characterization of lysosomal compartments

In mouse studies, TMEM192 has been confirmed as a lysosomal membrane protein through co-localization with LAMP-2 . Additionally, research in human cells has identified TMEM192 as part of the lysosomal membrane proteome, potentially involved in lysosomal tubulation and sorting processes .

Can TMEM192 function be linked to Xenopus regenerative processes?

Exploring TMEM192's potential role in Xenopus regeneration:

  • Expression analysis during regeneration:

    • Compare TMEM192 expression between regenerating and non-regenerating tissues

    • Temporal expression profiling during regeneration phases

    • Spatial mapping in regenerating structures

  • Functional perturbation during regeneration:

    • Knockdown TMEM192 in regenerating tissues using morpholinos

    • Assess impact on regeneration rate and completeness

    • Rescue experiments with wild-type protein

  • Integration with known regeneration pathways:

    • Analyze relationship with established regeneration factors (e.g., Wnt, FGF, BMP)

    • Investigate links to lysosomal signaling during regeneration

Xenopus laevis provides an excellent model for regeneration studies, particularly tail regeneration in tadpoles . Recent research has highlighted the importance of lysosomes in early dorsal signaling and regenerative processes in Xenopus , suggesting TMEM192 could play a role in these processes given its lysosomal localization.

How can structural studies of TMEM192 inform our understanding of its function in Xenopus?

Structural characterization of Xenopus TMEM192 can provide functional insights:

  • Structural prediction and modeling:

    • Generate homology models based on related structures

    • Predict functional domains and interaction interfaces

    • Identify conserved structural motifs across species

  • Experimental structure determination:

    • Express and purify domains for X-ray crystallography

    • Use cryo-EM for full-length protein in membrane mimetics

    • Employ NMR for soluble domain structure determination

  • Structure-guided functional studies:

    • Design mutations targeting key structural elements

    • Perform structure-function correlation studies

    • Identify potential ligand-binding sites

Unlike human TMEM192, which forms disulfide-linked dimers, mouse TMEM192 exists primarily as a monomer due to the absence of the critical C-terminal cysteine (C266 in human) . Xenopus TMEM192 similarly lacks this cysteine, suggesting it may also function as a monomer, though this requires experimental confirmation.

What approaches can resolve contradictory findings between Xenopus TMEM192 and its mammalian counterparts?

When addressing contradictory findings across species:

  • Cross-species complementation:

    • Express Xenopus TMEM192 in mammalian knockout cells

    • Test if function is restored

    • Identify species-specific differences in activity

  • Domain swapping experiments:

    • Create chimeric proteins with domains from different species

    • Identify which regions confer species-specific properties

    • Map functional domains through systematic swapping

  • Comparative biochemical analysis:

    • Side-by-side functional assays under identical conditions

    • Detailed kinetic or binding parameter comparisons

    • Analysis of post-translational modifications across species

  • Context-dependent function testing:

    • Analyze function in different cellular contexts

    • Test under various physiological stresses

    • Examine developmental stage-specific functions

One notable difference already identified is that mouse TMEM192 does not form disulfide-linked dimers unlike its human counterpart . This raises questions about whether Xenopus TMEM192 behaves more like the mouse or human protein, and what functional implications these structural differences might have.

How can TMEM192 research in Xenopus contribute to understanding human lysosomal disorders?

Translational applications of Xenopus TMEM192 research:

  • Disease modeling:

    • Generate Xenopus models with TMEM192 mutations mimicking human conditions

    • Analyze phenotypic outcomes relevant to lysosomal disorders

    • Test therapeutic interventions in these models

  • Pathway conservation analysis:

    • Compare lysosomal pathways between Xenopus and humans

    • Identify conserved elements that could be therapeutic targets

    • Determine species-specific differences that might limit translation

  • Drug screening platforms:

    • Develop Xenopus-based assays for compound screening

    • Assess effects on TMEM192-dependent processes

    • Validate hits in mammalian systems

Xenopus offers several advantages for disease modeling, including external development, easy manipulation, and conservation of many disease-relevant pathways . Recent studies have highlighted the importance of lysosomes in Xenopus development and signaling , providing context for investigating TMEM192's potential role in disease processes.

What are the critical controls needed when investigating TMEM192 function in Xenopus?

Robust experimental design requires appropriate controls:

Experimental ApproachEssential ControlsValidation Methods
Antibody-based detectionPre-immune serum controls, Peptide competition assays, TMEM192-depleted samplesWestern blot, Immunoprecipitation, Mass spectrometry
Recombinant protein studiesPurification tag-only controls, Heat-denatured protein controlsSDS-PAGE purity assessment, Mass spectrometry verification
Knockdown/knockout studiesScrambled/mismatch morpholinos, Rescue with morpholino-resistant constructsRT-qPCR, Western blot, Phenotypic rescue
Localization studiesMultiple fixation methods, Co-localization with known markersPearson's correlation coefficient analysis

When studying lysosomal functions related to TMEM192, appropriate controls include bafilomycin A1 treatment (which inhibits lysosomal acidification) and comparison with known lysosomal membrane proteins .

How should researchers interpret TMEM192 functional data across different developmental stages of Xenopus?

Developmental context considerations:

  • Stage-specific protein interactions:

    • Perform interaction studies at multiple developmental timepoints

    • Consider maternal versus zygotic protein pools

    • Account for changing cellular compositions of tissues

  • Temporal expression analysis:

    • Compare expression levels throughout development

    • Correlate with developmental transitions

    • Account for tissue-specific expression patterns

  • Functional redundancy assessment:

    • Identify potential compensatory mechanisms at different stages

    • Consider paralogs or functionally similar proteins

    • Perform combinatorial knockdown experiments

Xenopus development provides unique opportunities to study protein function across dramatically different cellular contexts, from early cleavage through metamorphosis . When interpreting data, researchers should consider that TMEM192 might have different binding partners or functions at different developmental stages.

What special considerations apply to biochemical studies of Xenopus TMEM192 as a membrane protein?

Membrane protein-specific technical considerations:

  • Extraction and solubilization:

    • Screen multiple detergents (DDM, CHAPS, digitonin recommended for initial trials)

    • Optimize detergent-to-protein ratios

    • Consider detergent-free methods (SMALPs, nanodiscs)

  • Stability and storage:

    • Test multiple buffer conditions (pH 7.2-7.5 typically optimal)

    • Include stabilizers (glycerol, specific lipids)

    • Assess stability by size-exclusion chromatography

  • Functional reconstitution:

    • Incorporate into liposomes for transport studies

    • Use proteoliposomes for activity assays

    • Consider native membrane extraction approaches

  • Post-translational modification analysis:

    • Assess glycosylation status in different expression systems

    • Identify phosphorylation sites by mass spectrometry

    • Compare modification patterns with mammalian orthologs

Studies of mouse TMEM192 have successfully used detergent extraction followed by immunoprecipitation to study protein interactions , suggesting similar approaches would work for Xenopus TMEM192.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.