Recombinant Xenopus laevis Transmembrane protein 205 (tmem205)

Shipped with Ice Packs
In Stock

Description

Introduction to Xenopus laevis Transmembrane Protein 205

Transmembrane protein 205 (tmem205) is a membrane-spanning protein found in Xenopus laevis, commonly known as the African clawed frog. This protein belongs to the broader family of transmembrane proteins that play critical roles in cellular function by facilitating communication between intracellular and extracellular environments. The native tmem205 protein is characterized by its multiple membrane-spanning regions and is identified in protein databases with the UniProt identification code Q6GPW4 . The full-length protein consists of 188 amino acid residues and contains several hydrophobic segments that anchor it within cellular membranes. While the specific biological function of tmem205 in Xenopus laevis remains to be fully characterized, recombinant production of this protein enables researchers to study its structure, function, and potential applications in various biochemical and cellular assays.

Expression Systems

Recombinant Xenopus laevis tmem205 is typically produced using bacterial expression systems, specifically Escherichia coli (E. coli) . The bacterial expression system offers several advantages for protein production, including rapid growth, high protein yields, and cost-effectiveness. The expression construct typically includes the full-length tmem205 sequence (amino acids 1-188) fused to an affinity tag to facilitate purification.

Affinity Tags and Purification Strategies

The recombinant tmem205 protein is commonly produced with an N-terminal histidine (His) tag . This affinity tag consists of multiple histidine residues that bind with high affinity to metal ions such as nickel (Ni²⁺). This property is exploited during purification, where the His-tagged protein can be selectively captured on a nickel-nitrilotriacetic acid (Ni-NTA) affinity column while contaminant proteins are washed away. Following affinity chromatography, additional purification steps may include gel filtration chromatography to ensure high purity of the final product. The resulting purified protein typically demonstrates greater than 90% purity as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) .

Physical Form and Stability

Commercially available recombinant Xenopus laevis tmem205 is typically supplied as a lyophilized powder, which enhances stability during storage and transportation . The lyophilized form preserves the structural integrity of the protein and extends its shelf life. Upon reconstitution, the protein can be prepared at various concentrations suitable for downstream applications.

Functional Characterization

While the specific biological function of tmem205 in Xenopus laevis has not been fully characterized, the availability of the recombinant protein allows researchers to perform various functional assays to elucidate its role. These may include:

  1. Reconstitution into artificial membrane systems to study transport or channel activities

  2. Interaction studies with potential ligands or binding partners

  3. Investigation of post-translational modifications and their functional significance

  4. Cellular localization studies using fluorescently labeled antibodies against the recombinant protein

ELISA and Immunological Applications

The recombinant protein is suitable for enzyme-linked immunosorbent assay (ELISA) applications, as indicated by commercial availability of ELISA kits utilizing this protein . These applications may include:

  1. Development of diagnostic assays

  2. Quantification of tmem205 in various biological samples

  3. Screening for compounds that interact with tmem205

  4. Evaluation of antibody specificity and sensitivity

Reconstitution and Handling

When preparing the protein for experimental use, the following recommendations should be followed:

  1. Briefly centrifuge the vial prior to opening to ensure contents are at the bottom

  2. Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 50% for long-term storage

  4. Create small working aliquots to minimize freeze-thaw cycles

  5. The reconstituted protein is typically stable in Tris-based buffer containing 50% glycerol

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
tmem205; Transmembrane protein 205
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem205
Target Protein Sequence
MVAEGDPGNLVKIFHLLVLSASWGMQCWMTFVAGFVLIKGVPRHTFGLVQSKLFPYYNHI VLCCSFISLAIYAAYHPRELLSPSESVQISLFFTSLLVAALQARWFSPVTTKTMFKMHVI EREHSLGQGVGLSANKEGYQLLQEKDPKYKALRKRFMRYHGISSLCNLLCLLCNGANLVY IALLMPTL
Uniprot No.

Target Background

Database Links

KEGG: xla:444019

UniGene: Xl.47600

Protein Families
TMEM205 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Xenopus laevis tmem205?

Xenopus laevis transmembrane protein 205 (tmem205) is a 188 amino acid protein with multiple transmembrane domains. The full amino acid sequence is: MVAEGDPGNLVKIFHLLVLSASWGMQCWMTFVAGFVLIKGVPRHTFGLVQSKLFPYYNHIVLCCSFISLAIYAAYHPRELLSPSESVQISLFFTSLLVAALQARWFSPVTTKTMFKMHVIEREHSLGQGVGLSANKEGYQLLQEKDPKYKALRKRFMRYHGISSLCNLLCLLCNGANLVYIALLMPTL . This sequence indicates a protein with hydrophobic domains characteristic of membrane proteins. Researchers should analyze the protein using topology prediction software to identify transmembrane regions for studying structure-function relationships.

How does Xenopus laevis tmem205 compare to human TMEM205?

While both proteins belong to the same family, functional studies in human TMEM205 (hTMEM205) have revealed its role in platinum-based drug resistance mechanisms. Human TMEM205 is overexpressed in cancer cells resistant to cisplatin and mediates selective extrusion of certain platinum compounds, specifically cisplatin and oxaliplatin, but not carboplatin . Comparative analysis of the Xenopus laevis tmem205 with human TMEM205 would require sequence alignment, phylogenetic analysis, and functional studies to determine conservation of drug resistance mechanisms. This comparison is valuable for evolutionary studies and potential disease modeling using Xenopus as a system.

What expression systems are optimal for producing recombinant Xenopus laevis tmem205?

Based on available data, E. coli has been successfully used to express recombinant full-length Xenopus laevis tmem205 with N-terminal His tags . For functional studies, researchers should consider the following methodological approach:

  • Design expression constructs with appropriate fusion tags (His-tag demonstrated to work effectively)

  • Select bacterial strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Optimize induction conditions (temperature, IPTG concentration, induction time)

  • Implement membrane protein extraction protocols using appropriate detergents

  • Purify using affinity chromatography followed by size exclusion chromatography

Alternative expression systems such as insect cells or yeast may provide better folding for functional studies but require different vector systems and optimization protocols.

What are the optimal storage conditions for recombinant tmem205?

Recombinant tmem205 is typically provided as a lyophilized powder and should be stored according to specific protocols to maintain activity. The recommended storage protocol involves:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term at -20°C/-80°C

Researchers should verify protein stability using techniques such as circular dichroism or functional assays before and after storage to confirm preservation of structural integrity.

What purification techniques yield the highest quality tmem205 preparations?

High-quality purification of tmem205 requires a multi-step approach:

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Intermediate purification using ion exchange chromatography

  • Polishing step using size exclusion chromatography

  • Quality assessment using SDS-PAGE (purity >90% should be achieved)

  • Functional validation using appropriate assays

For membrane proteins like tmem205, detergent selection is critical. Researchers should screen multiple detergents (DDM, LMNG, etc.) for optimal extraction and stability during purification.

How can researchers investigate potential drug resistance functions of Xenopus laevis tmem205?

Based on findings from human TMEM205 studies, researchers can design experiments to investigate whether Xenopus laevis tmem205 exhibits similar platinum drug export functions:

  • Express tmem205 in model cell systems (similar to E. coli expression systems used for human TMEM205)

  • Perform cellular toxicity assays with various platinum compounds (cisplatin, oxaliplatin, carboplatin)

  • Quantify intracellular platinum accumulation in control vs. tmem205-expressing cells

  • Conduct mutagenesis studies targeting conserved residues between human and Xenopus proteins

  • Analyze cellular response using growth curves and morphological assessments

The recombinant expression platform coupled with in vivo functional resistance assays described for human TMEM205 provides a valuable methodological framework that could be adapted for Xenopus tmem205 .

What experimental approaches can identify potential binding partners of tmem205?

Identifying binding partners of tmem205 requires multiple complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS)

    • Express tagged tmem205 in appropriate cell systems

    • Cross-link to stabilize transient interactions

    • Purify complexes and identify interacting proteins by MS

  • Proximity-based labeling techniques

    • Fuse tmem205 to enzymes like BioID or APEX2

    • Allow in vivo biotinylation of proximal proteins

    • Purify and identify biotinylated proteins

  • Yeast two-hybrid or membrane yeast two-hybrid systems modified for membrane proteins

    • Screen against Xenopus cDNA libraries

    • Validate interactions using co-immunoprecipitation

  • Co-localization studies using fluorescently tagged proteins and high-resolution microscopy

What structural analysis techniques are appropriate for transmembrane proteins like tmem205?

Membrane proteins present unique challenges for structural analysis. Researchers should consider:

  • Cryo-electron microscopy (Cryo-EM)

    • Reconstitute purified tmem205 in nanodiscs or amphipols

    • Optimize sample preparation for single-particle analysis

    • Process data using specialized software for membrane protein reconstruction

  • X-ray crystallography

    • Screen detergents and lipids for crystal formation

    • Use lipidic cubic phase (LCP) crystallization techniques

    • Optimize crystallization conditions systematically

  • Nuclear Magnetic Resonance (NMR) for specific domains

    • Express isotopically labeled protein domains

    • Select appropriate membrane mimetics (detergent micelles, bicelles)

    • Collect multi-dimensional spectra for resonance assignment

  • Molecular dynamics simulations

    • Build homology models based on related proteins with known structures

    • Simulate protein behavior in lipid bilayers

    • Make predictions for experimental validation

How do mutations in conserved residues affect tmem205 function?

To investigate the functional significance of conserved residues between Xenopus and human TMEM205:

  • Perform sequence alignment to identify conserved residues, especially those implicated in drug resistance functions

  • Generate site-directed mutants focusing on:

    • Conserved cysteine or other sulfur-containing residues potentially involved in platinum binding

    • Residues in transmembrane domains that might form a translocation pathway

    • Residues in putative substrate binding pockets

  • Assess mutant function using:

    • Growth assays in presence of platinum compounds

    • Direct measurement of platinum transport

    • Structural stability assessments

Results from human TMEM205 studies suggest a sulfur-based translocation mechanism for platinum export , which could be further explored in the Xenopus ortholog through targeted mutagenesis of sulfur-containing residues.

Can Xenopus laevis tmem205 be used to study cancer drug resistance mechanisms?

Xenopus laevis tmem205 presents an opportunity to study evolutionary conservation of drug resistance mechanisms:

  • Generate stable cell lines expressing Xenopus tmem205

    • Use mammalian cancer cell lines with low endogenous TMEM205 expression

    • Create inducible expression systems for controlled experiments

  • Compare cisplatin sensitivity between:

    • Parental cells

    • Cells expressing human TMEM205

    • Cells expressing Xenopus tmem205

  • Analyze cross-resistance patterns to various platinum compounds

  • Examine intracellular localization patterns to determine if the Xenopus protein traffics to the same cellular compartments as human TMEM205

This comparative approach could identify conserved mechanisms and potentially reveal novel functions specific to each ortholog.

How can transgenic Xenopus models be used to study tmem205 in vivo?

Xenopus offers advantages for in vivo studies of tmem205 through transgenic approaches:

  • Design expression constructs with tissue-specific promoters

    • Consider both X. laevis (allotetraploid) and X. tropicalis (diploid) depending on experimental needs

    • X. tropicalis may be preferred for genetics studies due to its shorter generation time (4-6 months to adulthood) compared to X. laevis (6-12+ months)

  • Implement CRISPR/Cas9 genome editing to:

    • Generate knockout models

    • Create tagged endogenous versions for localization studies

    • Introduce specific mutations to study structure-function relationships

  • Analyze phenotypes across developmental stages and in response to chemical exposures

  • Consider the genetic complexity of X. laevis with its allotetraploid genome containing homeologous chromosome pairs designated as L (long) and S (short)

What functional assays can assess tmem205 activity in Xenopus embryos?

Researchers can employ several approaches to assess tmem205 function in Xenopus embryos:

  • Morpholino knockdown or CRISPR knockout followed by:

    • Assessment of embryonic development

    • Platinum compound sensitivity assays

    • Platinum accumulation measurements in tissues

  • Platinum drug exposure studies:

    • Determine LC50 values in wild-type vs. tmem205-modified embryos

    • Analyze tissue-specific platinum accumulation

    • Evaluate morphological and molecular responses

  • RNA-seq analysis to determine transcriptional changes:

    • Compare wild-type vs. tmem205-modified embryos

    • Analyze responses to platinum compound exposure

    • Identify potential compensatory mechanisms

The experimental design should account for the fact that X. laevis possesses homeologous genes due to its allotetraploid nature .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.