Recombinant Xenopus laevis Transmembrane protein 237 (tmem237)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem237; Transmembrane protein 237
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem237
Target Protein Sequence
MGKKQVALPRALPPMPSTSIDEIPHSRPKKKKTKSNNNTPDDVLQNAGFTTSENNDPLSP ERRKRKKKRFSIDAETSLTQNNPSIPVVLNGKDTDNQTTEEGATRKPRRRTKKTRLAEEE FPNELGVEDEDIIPDGHTKIPTQNPAFLASSLTSQPVGKLFVEKNRRFQAADRSEIIKTT EQMDVFLDVKPTWSSMDVSLTAHHIFRMVGLFCCGFLAGYAVWNIVVIYVLAGSQLTNLP NLLQTYKILAYPSQCFLYFLLVLSTVTAFDRIDLERAADALRGLLKLDPAAVASFFYFVA LFLVLSQQMTSDRMNFYTPPTQNGSLWQTDTEGQILQPWIVINLVVAILVGLAWLFLSCR PDIDHSEEAMFIPEEEDYPDMEKGMKIQG
Uniprot No.

Target Background

Function
Transmembrane protein 237 (TMEM237) is a component of the transition zone in primary cilia. It plays a crucial role in ciliogenesis, the process of cilia formation.
Database Links

KEGG: xla:100137642

UniGene: Xl.45721

Protein Families
TMEM237 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.

Q&A

What is TMEM237 and what is its significance in ciliopathy research?

TMEM237 (previously known as ALS2CR4) encodes a predicted tetraspan transmembrane protein that localizes to the ciliary transition zone (TZ). Mutations in TMEM237 have been identified in individuals affected with Joubert syndrome related disorders (JSRDs), which are ciliopathies characterized by cerebellar abnormalities and other developmental phenotypes. TMEM237 is important for ciliogenesis and proper ciliary function across multiple species including mammals, zebrafish, and C. elegans. Loss of TMEM237 results in defective ciliogenesis and deregulation of important developmental signaling pathways such as Wnt signaling . The protein functions within a complex network of TZ-associated proteins that collectively participate in basal body-TZ anchoring to the membrane and establishing a functional ciliary gate during ciliogenesis .

Why use Xenopus laevis as a model system for studying TMEM237?

Xenopus laevis serves as an excellent model system for studying developmental processes including those regulated by ciliary proteins like TMEM237. This amphibian model offers several advantages: (1) large, externally developing embryos that are easily manipulated; (2) well-characterized developmental stages; (3) amenability to transgenesis techniques; (4) conservation of key developmental pathways with mammals; and (5) the availability of inducible gene expression systems to control transgene activation at specific developmental timepoints . Additionally, Xenopus undergoes metamorphosis, providing a unique opportunity to study gene function during this dramatic developmental transition. The sperm-mediated transgenesis method has been successfully applied to X. laevis, allowing for the introduction of genes before first cleavage, with faithful expression patterns transmitted to subsequent generations .

How does TMEM237 interact with other transition zone proteins?

TMEM237 functions within a complex interaction network of transition zone (TZ) proteins. Studies in C. elegans have shown that TMEM237 (JBTS-14 in C. elegans) genetically interacts with NPHP-4, another TZ protein, to control basal body-TZ anchoring to the membrane and ciliogenesis . Both mammalian and C. elegans TMEM237/JBTS-14 require RPGRIP1L/MKS5 for proper TZ localization. Additional functional interactions have been demonstrated between C. elegans JBTS-14 and other TZ proteins including MKS-2/TMEM216, MKSR-1/B9D1, and MKSR-2/B9D2 . These interactions collectively contribute to establishing and maintaining the ciliary gate function, which is essential for proper cilia formation and function.

What are the mechanisms by which TMEM237 regulates Wnt signaling in Xenopus laevis?

TMEM237 has been implicated in the regulation of Wnt signaling pathways, which are crucial for proper embryonic development. In studies on other model organisms, loss of TMEM237 results in deregulation of Wnt signaling . In the context of Xenopus laevis, recombinant TMEM237 can be used to investigate this regulatory relationship. The mechanism likely involves TMEM237's role in maintaining proper ciliary structure and function, which in turn affects the localization and activity of Wnt pathway components. Research suggests that defective ciliogenesis resulting from TMEM237 dysfunction may disrupt the balance between canonical and non-canonical Wnt signaling, potentially through alterations in the ciliary localization of receptors or intracellular transduction components. To study this in Xenopus, researchers can utilize inducible expression systems, such as the RU-486 or tetracycline-controlled systems, to express wild-type or mutant forms of TMEM237 at specific developmental stages and assess subsequent effects on Wnt target gene expression and developmental outcomes .

How can transgenic Xenopus laevis models be optimized for studying TMEM237 mutations associated with Joubert syndrome?

Creating optimized transgenic Xenopus models for studying TMEM237 mutations requires careful consideration of several factors:

  • Inducible expression systems: Given that constitutive expression of mutant proteins might be lethal during early development, binary inducible systems such as the RU-486/mifepristone-inducible system or the tetracycline (Tet)-inducible system are particularly valuable . The Tet-on system allows gene expression to be induced by the addition of doxycycline at specific developmental stages, which is ideal for studying metamorphosis and later developmental events.

  • Tissue-specific promoters: To study TMEM237's function in specific tissues relevant to Joubert syndrome (e.g., brain, kidney, retina), tissue-specific promoters should be employed. For neural-specific expression, promoters such as those used in the improved Tet-on system can be implemented .

  • Mutation selection: Researchers should prioritize introducing human TMEM237 mutations that have been directly linked to Joubert syndrome patients. These can be identified through genetic studies of affected families, as demonstrated in the Tyrol families research approach .

  • Readout systems: Incorporating reporter genes (e.g., GFP fusion proteins) facilitates visualization of protein localization and expression levels. Luciferase reporters can be used to quantify expression levels in response to inducers, as demonstrated with the RU-486 system .

  • Germ-line transmission: Establishing stable transgenic lines is crucial for reproducible studies. The F₁ progeny should be screened for transgene integration and response to inducers to ensure reliable transmission of the intended genotype .

What are the differences in TMEM237 function between embryonic development and metamorphosis in Xenopus laevis?

This question requires comparative analysis of TMEM237 function across different developmental stages. Based on our understanding of ciliary proteins and developmental processes in Xenopus:

During embryonic development, TMEM237 likely contributes to essential processes such as neural tube formation, left-right asymmetry determination, and kidney development - all processes that require functional cilia. During metamorphosis, TMEM237 may play roles in tissue remodeling, particularly in organs that undergo significant restructuring such as the nervous system, digestive tract, and limbs.

To study these stage-specific functions experimentally, the inducible gene expression systems described for Xenopus laevis provide an ideal approach. The RU-486 inducible system has demonstrated robust transgene induction with at least an order of magnitude increase in expression upon administration of the inducer . Similarly, the improved Tet-on system allows for tight control of expression with low baseline and robust induction by doxycycline .

A comparative study would involve:

  • Expression analysis of endogenous TMEM237 across developmental stages

  • Stage-specific induction of wild-type or mutant TMEM237

  • Assessment of phenotypic outcomes in different organ systems

  • Analysis of interacting partners at different developmental stages

What are the optimal techniques for expressing recombinant TMEM237 in Xenopus laevis?

Several approaches can be used for expressing recombinant TMEM237 in Xenopus laevis, each with specific advantages:

Transgenesis Methods:

  • Restriction enzyme-mediated integration (REMI): This established method introduces genes into X. laevis embryos before first cleavage, allowing for stable integration and transgene expression that can be transmitted to subsequent generations .

  • Binary inducible expression systems: For potentially toxic proteins like mutant forms of TMEM237, inducible systems offer significant advantages.

    • RU-486/mifepristone system: Utilizes a modified progesterone receptor ligand-binding domain fused to GAL4 DNA-binding domain and VP16 activation domain (GLVP). Upon binding of RU-486, this chimeric transcription factor activates expression of the gene of interest placed downstream of UAS elements .

    • Tetracycline (Tet-on) system: In this system, gene expression is induced by the addition of doxycycline. The improved version demonstrates very low baseline expression and robust induction, making it suitable for precise temporal control .

  • Tissue-specific expression: Utilizing tissue-specific promoters allows targeting expression to relevant tissues, such as neural tissues or kidney, where TMEM237's function in ciliary processes is most relevant.

Expression Verification:
For quantitative assessment of induction, luciferase reporter assays have demonstrated at least a 10-fold increase in expression in response to RU-486 in transgenic tadpoles . GFP fusion proteins can be used for visualization of subcellular localization.

How can CRISPR/Cas9 be used to study TMEM237 function in Xenopus laevis?

CRISPR/Cas9 genome editing offers powerful approaches to study TMEM237 function in Xenopus laevis:

  • Knockout strategies: Complete deletion or frameshift mutations can be introduced to assess loss-of-function phenotypes. This approach is particularly valuable for studying genes involved in ciliopathies.

  • Knock-in strategies: Specific mutations identified in Joubert syndrome patients can be introduced to create disease models. Additionally, fluorescent tags can be inserted to monitor endogenous protein localization and dynamics.

  • Experimental design considerations:

    • Guide RNA design should account for the pseudotetraploid nature of X. laevis, potentially targeting conserved regions in both homeologs.

    • Verification of editing efficiency through sequencing and protein expression analysis is essential.

    • Phenotypic assessment should focus on ciliary structures and functions in relevant tissues.

  • Temporal control: Combining CRISPR/Cas9 with inducible expression systems allows for stage-specific gene disruption, which is valuable for studying genes like TMEM237 that may have distinct functions throughout development.

  • Mosaic analysis: F₀ mosaic embryos can provide rapid insights before establishing stable lines, particularly useful for initial characterization of phenotypes.

What are the most effective antibodies and immunofluorescence protocols for studying TMEM237 localization in Xenopus laevis tissues?

Based on research methodologies for studying ciliary proteins:

Antibody Selection:

  • Custom antibodies against Xenopus TMEM237: Custom-raised antibodies against specific epitopes of Xenopus TMEM237 would provide optimal specificity. Research has utilized custom antibodies for studying transmembrane proteins in mammals (e.g., rabbit anti-Tmem237) .

  • Cross-reactive antibodies: Some commercial antibodies raised against human or mouse TMEM237 may cross-react with the Xenopus protein due to sequence conservation. Thorough validation is essential.

  • Epitope tags: For recombinant expression, epitope tags (e.g., FLAG, HA, or myc) can be fused to TMEM237, allowing detection with highly specific commercial antibodies.

Immunofluorescence Protocol Optimization:

  • Fixation: For ciliary transition zone proteins, optimal fixation typically involves 4% paraformaldehyde followed by methanol post-fixation to preserve ciliary structures.

  • Antigen retrieval: May be necessary depending on the tissue and antibody used.

  • Blocking: BSA (3-5%) with normal serum from the secondary antibody species.

  • Co-staining markers: Include ciliary markers such as acetylated α-tubulin (ciliary axoneme) and γ-tubulin (basal bodies) to precisely define TMEM237's localization within the ciliary transition zone.

  • Tissue preparation: Cryosections (10-12 μm) typically work well for Xenopus tissues, though whole-mount immunofluorescence may be suitable for embryos and thin tissues.

  • Controls: Include appropriate negative controls (secondary antibody only, pre-immune serum) and positive controls (known ciliated tissues).

How should researchers interpret phenotypic data from TMEM237 studies in the context of human ciliopathies?

When interpreting phenotypic data from TMEM237 studies in Xenopus laevis, researchers should consider several factors to establish relevance to human ciliopathies:

  • Comparative analysis framework:

FeatureXenopus PhenotypeHuman JSRD PhenotypeInterpretation
CNS developmentNeural tube defects, brain malformationsCerebellar vermis hypoplasia, "molar tooth sign" on MRIDirect correlation suggests conserved developmental mechanisms
KidneyPronephric defects, cyst formationNephronophthisisConsistent with ciliary dysfunction in both species
RetinaRetinal development abnormalitiesRetinal dystrophyIndicates conserved role in retinal ciliogenesis
LimbSkeletal abnormalitiesPolydactylyReflects role in Hedgehog signaling regulation
  • Mechanistic validation: Phenotypic similarities should be supported by mechanistic studies demonstrating comparable molecular pathways are affected. For example, if Wnt signaling deregulation is observed in both human patients and Xenopus models with TMEM237 mutations, this strengthens the cross-species relevance .

  • Rescue experiments: The ability of human TMEM237 to rescue Xenopus phenotypes (or vice versa) provides strong evidence for functional conservation. This can be assessed using the inducible expression systems described previously .

  • Consideration of species-specific differences: Some phenotypes may manifest differently due to species-specific anatomy and developmental timing. These differences should be acknowledged and contextually interpreted.

  • Quantitative phenotyping: Whenever possible, phenotypes should be quantified rather than qualitatively described, enabling statistical analysis and more rigorous comparisons across species.

What bioinformatic approaches are most useful for analyzing TMEM237 structure and predicting the impact of mutations?

Several bioinformatic approaches can be employed to analyze TMEM237 structure and predict mutation impacts:

  • Sequence-based analyses:

    • Multiple sequence alignments across species to identify conserved domains

    • Identification of functional motifs using tools like PROSITE, PFAM

    • Prediction of transmembrane domains using TMHMM, Phobius, or TMpred

    • Conservation analysis to identify evolutionarily constrained residues

  • Structural modeling:

    • Ab initio or homology modeling of TMEM237 using tools like I-TASSER, SWISS-MODEL

    • Molecular dynamics simulations to assess stability of wild-type vs. mutant protein

    • Analysis of protein-protein interaction interfaces

    • Prediction of post-translational modifications and their impact on function

  • Mutation impact prediction:

    • SIFT, PolyPhen-2, or PROVEAN to predict functional impacts of amino acid substitutions

    • Analysis of mutation location relative to functional domains and transmembrane regions

    • Prediction of effects on protein stability using tools like FoldX or CUPSAT

    • Assessment of potential impacts on protein-protein interactions

  • Pathway analysis:

    • Integration of TMEM237 into ciliary protein interaction networks

    • Prediction of disrupted pathways based on known interacting partners

    • Analysis of co-expression patterns with other ciliary genes across tissues and developmental stages

  • Species-specific considerations for Xenopus laevis:

    • Account for gene duplication in this pseudotetraploid species

    • Compare homeologs (if present) to understand potential subfunctionalization

    • Consider developmental stage-specific expression patterns

How can researchers effectively integrate multi-omics data to better understand TMEM237 function in ciliary biology?

Integrating multi-omics approaches provides a comprehensive understanding of TMEM237 function:

  • Transcriptomic integration:

    • RNA-seq data across developmental stages can reveal temporal expression patterns

    • Single-cell RNA-seq can identify cell types expressing TMEM237

    • Comparison of wild-type vs. TMEM237 mutant transcriptomes can identify dysregulated pathways

    • Integration with ChIP-seq data can connect transcriptional changes to specific regulators

  • Proteomic approaches:

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to TMEM237 at the ciliary transition zone

    • Co-immunoprecipitation followed by mass spectrometry to identify direct interacting partners

    • Phosphoproteomics to identify signaling pathways affected by TMEM237 dysfunction

    • Quantitative proteomics comparing wild-type and mutant conditions

  • Structural biology integration:

    • Cryo-EM studies of transition zone complexes containing TMEM237

    • X-ray crystallography of TMEM237 domains

    • NMR studies of protein-protein interactions

  • Imaging data integration:

    • Super-resolution microscopy to precisely localize TMEM237 within the transition zone

    • Live imaging to track dynamics during ciliogenesis

    • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructural features

  • Data visualization and integration:

    • Network analysis tools to visualize protein interaction networks

    • Pathway enrichment analysis to identify affected biological processes

    • Multi-omics data integration platforms (e.g., Cytoscape, STRING)

    • Machine learning approaches to identify patterns across diverse datasets

What are the most common challenges in generating stable transgenic Xenopus laevis lines expressing TMEM237, and how can they be overcome?

Researchers commonly encounter several challenges when generating stable transgenic Xenopus lines expressing TMEM237:

  • Embryonic lethality: Constitutive expression of mutant TMEM237 may cause developmental defects leading to embryonic lethality.

    • Solution: Implement inducible expression systems such as the RU-486 or tetracycline-inducible systems to activate the transgene at specific developmental stages . The Tet-on system is particularly advantageous as it allows gene expression to be induced by addition of doxycycline at precisely timed intervals .

  • Variable expression levels: Transgene expression may vary significantly between different founder animals.

    • Solution: Screen multiple founder lines using quantitative assays such as luciferase reporter assays, which have demonstrated at least 10-fold induction in response to inducers in Xenopus . Select lines with optimal expression characteristics for breeding and experimental analysis.

  • Mosaic expression: F₀ transgenic animals often show mosaic expression patterns.

    • Solution: Establish stable F₁ lines by breeding F₀ founders to wild-type animals and screening offspring for uniform transgene expression. Analyses should focus on F₁ or later generations to ensure consistent expression patterns .

  • Protein localization issues: Recombinant TMEM237 may not properly localize to the ciliary transition zone.

    • Solution: Include proper trafficking signals in the construct design and verify subcellular localization using GFP fusion proteins. Consider co-expressing interacting partners like RPGRIP1L/MKS5 that are known to be required for proper TMEM237 localization to the transition zone .

  • Transgene silencing: Epigenetic silencing may occur over generations.

    • Solution: Monitor expression levels across generations and consider including insulator elements in the construct design to prevent positional effects and silencing.

How can researchers accurately assess ciliary defects resulting from TMEM237 dysfunction in Xenopus tissues?

Accurate assessment of ciliary defects requires multiple complementary approaches:

  • Electron microscopy techniques:

    • Transmission Electron Microscopy (TEM) provides ultrastructural analysis of ciliary organization, similar to methods used for C. elegans .

    • Scanning Electron Microscopy (SEM) visualizes ciliary surface features and density.

    • Sample preparation is critical - standardized fixation protocols should be used consistently.

  • Immunofluorescence microscopy:

    • Co-staining with ciliary markers: acetylated α-tubulin (axoneme), γ-tubulin (basal bodies), and transition zone markers.

    • Quantification parameters should include cilia number, length, and morphology.

    • Super-resolution techniques (STED, STORM) can provide detailed views of transition zone architecture.

  • Functional assays:

    • Ciliary motility can be assessed in tissues with motile cilia (e.g., epidermis) using high-speed videomicroscopy.

    • Flow detection assays in pronephric tubules to assess function of sensory cilia.

    • Calcium imaging to assess ciliary signaling responses.

  • Molecular readouts:

    • Analysis of canonical and non-canonical Wnt signaling activation using reporter constructs.

    • Assessment of Hedgehog pathway activity, which relies on functional primary cilia.

    • Quantification of ciliary protein localization using fluorescence intensity measurements.

  • Developmental phenotyping:

    • Systematic assessment of phenotypes associated with ciliary dysfunction (kidney cysts, neural tube defects, left-right asymmetry defects).

    • Standardized scoring systems for each phenotype to enable statistical comparisons.

What are the most promising approaches for developing TMEM237-based therapeutic strategies for ciliopathies?

While direct therapeutic applications are still distant, several promising research directions could lead to therapeutic strategies:

  • Gene therapy approaches:

    • AAV-mediated delivery of functional TMEM237 to affected tissues

    • Development of Xenopus models to test efficacy and safety of gene replacement strategies

    • CRISPR-based gene correction of patient-specific mutations

  • Small molecule screening:

    • Development of high-throughput assays using Xenopus embryos to identify compounds that can rescue TMEM237 mutant phenotypes

    • Focus on molecules that can stabilize mutant protein, enhance ciliary trafficking, or modulate downstream signaling pathways

  • Protein replacement strategies:

    • Design of recombinant TMEM237 with enhanced cell-penetrating capabilities

    • Exploration of exosome-based delivery systems for transmembrane proteins

  • Pathway modulation:

    • Identification of druggable targets in pathways affected by TMEM237 dysfunction

    • Testing Wnt pathway modulators as potential therapeutics, given TMEM237's role in regulating Wnt signaling

  • Personalized medicine approaches:

    • Establishing patient-specific models in Xenopus through expression of patient-derived TMEM237 variants

    • Tailoring therapeutic strategies based on specific mutations and affected pathways

How might single-cell technologies advance our understanding of TMEM237 function in development and disease?

Single-cell technologies offer unprecedented resolution for studying TMEM237:

  • Single-cell transcriptomics:

    • Identification of cell populations most affected by TMEM237 dysfunction

    • Temporal mapping of gene expression changes during development

    • Reconstruction of developmental trajectories altered by TMEM237 mutations

    • Assessment of compensatory mechanisms in specific cell types

  • Spatial transcriptomics:

    • Mapping TMEM237 expression patterns with spatial context

    • Identifying tissue regions with coordinated expression of TMEM237 and interacting partners

    • Correlating localized gene expression changes with morphological defects

  • Single-cell proteomics:

    • Quantification of protein levels and post-translational modifications at single-cell resolution

    • Analysis of protein-protein interaction networks in specific cell types

  • Lineage tracing combined with TMEM237 perturbation:

    • Following cell fate decisions in the context of TMEM237 dysfunction

    • Identifying critical developmental windows where TMEM237 function is essential

  • Single-cell CRISPR screens:

    • Identification of genetic modifiers that enhance or suppress TMEM237 phenotypes

    • Mapping genetic interactions within the ciliary transition zone network

These technologies, when applied to the Xenopus model system, could provide insights into how TMEM237 dysfunction affects specific cell populations and developmental processes, potentially identifying new therapeutic targets and intervention points.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.