Recombinant Xenopus laevis Transmembrane protein 41B (tmem41b)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Transmembrane protein 41B

Transmembrane protein 41B (TMEM41B) is a conserved protein found across multiple species with emerging roles in several cellular processes. The Xenopus laevis variant represents an important research tool for studying fundamental biological mechanisms. Recombinant TMEM41B from Xenopus laevis is produced under laboratory conditions to enable detailed investigation of its structure and function without the complexities of whole-organism studies.

The African clawed frog (Xenopus laevis) has long served as a valuable model organism in developmental biology and molecular research due to its large embryos, external development, and genetic similarities to mammals in many conserved pathways. Studying TMEM41B in this context provides valuable comparative insights that may be applicable to understanding human biology and disease mechanisms.

Production and Purification Methods

The production of recombinant Xenopus laevis TMEM41B typically follows standardized protocols for membrane protein expression. Based on available commercial product information, the protein is often produced with specific tags to facilitate purification and downstream applications.

ParameterSpecification
Expression Region1-278 (full length protein)
SourceTypically E. coli or mammalian expression systems
Tag TypeOften includes His-tag or other affinity tags
FormLyophilized powder
Storage BufferTris-based buffer, 50% glycerol, optimized for protein stability
Storage Conditions-20°C for extended storage
NotesRepeated freezing and thawing is not recommended

For optimal experimental results, the recombinant protein requires proper handling and storage. Working aliquots are typically maintained at 4°C for up to one week to preserve protein integrity and functionality . The protein's relatively high purity (typically >80%) makes it suitable for a wide range of biochemical and cellular assays.

Function as an Endoplasmic Reticulum Ca²⁺ Channel

A groundbreaking discovery about TMEM41B is its function as an endoplasmic reticulum (ER) Ca²⁺ release channel. Recent research has identified TMEM41B as "a novel type of concentration-dependent ER Ca²⁺ release channel" . This function represents a significant advancement in understanding how cells regulate calcium homeostasis.

The absence of TMEM41B has been shown to cause ER Ca²⁺ overload, triggering downstream signaling cascades with profound effects on cellular function. In T cells, TMEM41B deficiency leads to upregulation of IL-2 and IL-7 receptors and increased basal signaling through the JAK-STAT, AKT-mTOR, and MAPK pathways .

While these findings derive from studies not specifically focusing on the Xenopus laevis variant, the high conservation of TMEM41B across species suggests similar mechanisms likely operate in the African clawed frog model. This calcium channel function positions TMEM41B as a potential regulator of numerous calcium-dependent cellular processes.

Metabolic Regulation and Cellular Homeostasis

Beyond its roles in autophagy and calcium signaling, TMEM41B appears to be involved in maintaining cellular metabolic states. Research indicates that TMEM41B plays a crucial role in preserving "T cell metabolic quiescence and responsiveness" . This function has significant implications for understanding how cells transition between different metabolic states.

The protein's involvement in metabolic regulation suggests it may serve as a link between calcium signaling, autophagy, and cellular energy management. This interconnected role positions TMEM41B as a potential central regulator of cellular homeostasis across different physiological contexts.

Research Applications and Experimental Utility

The recombinant Xenopus laevis TMEM41B protein serves as a valuable tool for diverse research applications. Its availability in purified form facilitates detailed biochemical and structural studies that would be challenging to perform in whole-organism contexts.

Common research applications include:

ApplicationDescription
ELISA AssaysDetection and quantification in complex biological samples
Structural StudiesInvestigation of protein folding and membrane integration
Protein-Protein Interaction StudiesIdentification of binding partners and functional complexes
Antibody ProductionGeneration of specific antibodies for immunological detection
Functional ReconstitutionAnalysis of channel activity in controlled membrane systems

The recombinant protein can be used as a positive control in experiments investigating native TMEM41B expression or as a standard for developing quantitative assays. Its defined sequence and purity make it particularly valuable for reproducible experimental protocols requiring consistent protein quality.

Comparative Analysis with TMEM41B from Other Species

Comparing Xenopus laevis TMEM41B with its counterparts in other species provides valuable insights into evolutionary conservation and functional significance. The human TMEM41B protein consists of 291 amino acids , while the Xenopus laevis variant contains 278 amino acids , indicating a high degree of conservation with some species-specific variations.

Sequence alignment analysis shows significant homology in key functional domains, particularly in the transmembrane regions that are critical for the protein's membrane integration and channel function. This conservation underscores the biological importance of TMEM41B across diverse species and supports the relevance of Xenopus laevis as a model for studying TMEM41B's fundamental functions.

The mouse TMEM41B protein shares structural similarities with both human and Xenopus variants, further highlighting the evolutionary conservation of this protein . These comparative analyses provide a framework for understanding which aspects of TMEM41B function are likely to be universal across species and which may represent species-specific adaptations.

Current Research Trends and Future Directions

Current research on TMEM41B encompasses several exciting directions that promise to expand our understanding of this multifunctional protein. Recent studies have revealed additional roles beyond autophagy and calcium regulation, including "lipid scrabbling and viral infections" , suggesting even broader cellular functions than previously recognized.

For Xenopus laevis TMEM41B specifically, future research may focus on:

  1. Detailed structural characterization using advanced imaging techniques

  2. Investigation of tissue-specific expression patterns during development

  3. Analysis of its role in specialized cellular contexts such as photoreceptors, where autophagy processes have been well-characterized

  4. Development of selective modulators to probe its function in living systems

The connection between TMEM41B's calcium channel function and its role in autophagy represents a particularly promising area for future investigation. Understanding how these functions are integrated could provide important insights into cellular response mechanisms under various physiological and pathological conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill it.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us and we will prioritize its development.
Synonyms
tmem41b; Transmembrane protein 41B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem41b
Target Protein Sequence
MQVHERSHTGGHTFQCNHGNEKKAPAAGKVHSEGGSARMSLLILVSIFLCAASVMFLVYK YFPQLSEEELEKIKVPRDMDDAKALGKVLSKYKDTFYVEVLVAYFTTYIFLQTFAIPGSI FLSILSGFLYPFPLALFLVCLCSGLGASFCYLLSYLVGRPVVYKYLSDKAIKWSQQVERH RDHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFLGTFIGVAPPSFVAIKAGTTLYQ LTTAGEAVSWNSVIILMVLAVLSILPAIFQKKLKQKFE
Uniprot No.

Target Background

Function
Transmembrane protein 41B (TMEM41B) is a phospholipid scramblase involved in lipid homeostasis and membrane dynamics. It exhibits phospholipid scramblase activity toward cholesterol and phosphatidylserine, as well as phosphatidylethanolamine and phosphatidylcholine. TMEM41B is essential for autophagosome formation, participating in the early stages of autophagosome biogenesis at the endoplasmic reticulum (ER) membrane. It reequilibrates the leaflets of the ER as lipids are extracted by ATG2 (ATG2A or ATG2B) to mediate autophagosome assembly. Beyond autophagy, TMEM41B plays a role in other processes requiring phospholipid scramblase activity. It is also crucial for normal motor neuron development.
Database Links

KEGG: xla:495477

UniGene: Xl.1287

Protein Families
TMEM41 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endomembrane system.

Q&A

What is TMEM41B and what is its cellular localization?

TMEM41B is a transmembrane protein localized to the endoplasmic reticulum. It contains multiple transmembrane domains and functions as a calcium release channel in the ER membrane. The protein has been identified in various species, including Xenopus laevis (African clawed frog), where it is composed of 278 amino acids . TMEM41B shares a conserved DedA domain with another ER protein called VMP1, which confers lipid scramblase activity - the ability to facilitate bidirectional movement of lipids across membranes . This protein is ubiquitously expressed in various tissues and plays critical roles in multiple cellular processes including calcium homeostasis, autophagy, and lipid metabolism, making it an important subject for basic and translational research.

What are the known functions of TMEM41B?

TMEM41B serves multiple critical cellular functions:

  • ER calcium channel: Recent research has definitively established TMEM41B as an endoplasmic reticulum Ca²⁺ release channel . When activated, it facilitates calcium release from ER stores, which is essential for store-operated calcium entry (SOCE) - a fundamental calcium signaling mechanism in many cell types.

  • Autophagy regulation: TMEM41B knockout results in the accumulation of LC3-positive autophagosomes, indicating a critical role in autophagy progression . The protein appears to be involved in autophagosome formation and maturation.

  • Lipid metabolism: Cells with TMEM41B mutations demonstrate abnormal accumulation of lipid droplets, suggesting its involvement in lipid homeostasis .

  • Embryonic development: TMEM41B, in conjunction with VMP1, is required for primitive endoderm specification during embryonic development. Loss of both proteins leads to defects in WNT signaling and impairs the establishment of extra-embryonic endoderm stem (XEN) cells .

  • T cell responsiveness: TMEM41B regulates T cell activation through modulation of calcium signaling and influences CD5 expression, a negative regulator of T cell receptor signaling .

What is the structure of Xenopus laevis TMEM41B?

Xenopus laevis TMEM41B is a 278-amino acid transmembrane protein with multiple membrane-spanning domains. Its amino acid sequence includes:
"MQVHERSHTGGHTFQCNHGNEKKAPAAGKVHSEGGSARMSLLILVSIFLCAASVMFLVYKYFPQLSEEELEKIKVPRDMDDAKALGKVLSKYKDTFYVEVLVAYFTTYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYLLSYLVGRPVVYKYLSDKAIKWSQQVERHRDHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFLGTFIGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSVIILMVLAVLSILPAIFQKKLKQKFE"

The protein contains negatively charged amino acid residues (aspartic acid and glutamic acid) facing the ER lumen that are critical for its calcium channel function. Specifically, residues D91/93/94 (aspartate 91, 93, and 94) have been identified as functionally important, as simultaneous mutation of these residues to alanine results in partial loss of TMEM41B-mediated ER Ca²⁺ release function .

How can I use recombinant Xenopus laevis TMEM41B in my research?

Recombinant Xenopus laevis TMEM41B protein can be utilized in multiple experimental approaches:

  • Structural studies: The purified protein can be used for structural characterization using techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to determine the three-dimensional structure and identify functional domains.

  • Protein-protein interaction studies: The recombinant protein can serve as bait in pull-down assays, co-immunoprecipitation experiments, or yeast two-hybrid screens to identify interaction partners.

  • Antibody production: Immunization with recombinant TMEM41B can generate specific antibodies for immunoblotting, immunoprecipitation, or immunofluorescence applications.

  • In vitro functional assays: The purified protein can be reconstituted into liposomes or planar lipid bilayers for biophysical studies of its calcium channel and lipid scramblase activities. Electrophysiological recordings can be performed to measure calcium currents, as demonstrated in previous studies where asymmetric calcium concentrations (100:10 mM) were used to characterize TMEM41B channel properties .

  • Enzyme-linked immunosorbent assays (ELISA): The recombinant protein can be used to develop quantitative assays for detecting TMEM41B in biological samples or for screening potential binding partners or inhibitors.

When using recombinant TMEM41B, proper storage at -20°C or -80°C in appropriate buffer (typically Tris-based with 50% glycerol) is recommended, with working aliquots stored at 4°C for up to one week to avoid repeated freeze-thaw cycles .

What are effective approaches for studying TMEM41B function in Xenopus models?

Xenopus models offer several advantages for studying TMEM41B function:

  • CRISPR/Cas9 genome editing: This technique has been successfully employed to generate knockout animals in Xenopus tropicalis. Guide RNAs targeting conserved regions of TMEM41B can be designed using tools like CRISPRscan to ensure high mutagenic activity with minimal off-target effects . For TMEM41B studies, selecting guide RNAs targeting exons that encode critical functional domains (such as those containing the D91/93/94 residues) would be most effective.

  • Verification of knockout efficiency:

    • T7 Endonuclease I assay can be used to confirm successful indel formation

    • Sanger sequencing of PCR products spanning the target region provides definitive confirmation of mutations

    • RT-PCR can detect potential exon skipping events, which may occur as a consequence of certain mutations

  • Phenotypic analysis: Morphological differences between control and TMEM41B-mutant tadpoles can be examined using:

    • Stereomicroscopy for gross morphological assessment

    • Fluorescence microscopy (with GFP-expressing transgenic lines)

    • High-resolution microcomputed tomography (MicroCT) for detailed structural analysis

  • Functional assays: Calcium imaging using fluorescent indicators can be performed in isolated cells or tissues from TMEM41B-mutant Xenopus to evaluate alterations in calcium homeostasis and signaling.

When working with Xenopus models, it's important to note that the exon structure of the TMEM41B gene in Xenopus tropicalis and humans is identical, facilitating translation of findings between these model systems .

What methods can be used to assess TMEM41B's calcium channel function?

Several complementary approaches can be utilized to characterize TMEM41B's calcium channel function:

  • ER calcium measurements:

    • Genetically encoded ER calcium sensors such as G-CEPIA1er can be stably expressed in cell lines to directly monitor ER calcium levels in TMEM41B wild-type versus knockout or mutant cells

    • This approach has revealed significantly increased ER Ca²⁺ levels in TMEM41B-deficient cells both under steady-state conditions and after treatment with thapsigargin (an inhibitor of SERCA pumps), confirming TMEM41B's role in facilitating ER Ca²⁺ release

  • Store-operated calcium entry (SOCE) assays:

    • Standard SOCE protocols involve depleting ER Ca²⁺ stores (typically using thapsigargin) in Ca²⁺-free media, followed by re-addition of extracellular Ca²⁺

    • Calcium flux is monitored using fluorescent calcium indicators

    • Studies have shown blunted SOCE responses in TMEM41B-deficient cells, consistent with increased ER Ca²⁺ levels

  • Electrophysiological recordings:

    • Planar lipid bilayer recordings with purified TMEM41B can directly measure Ca²⁺ currents

    • Methodology includes adjusting membrane potential to the K⁺ equilibrium potential (50 mV) to eliminate K⁺ currents, then adding Ca²⁺ for recording

    • Inward step-like signals observed upon addition of 40 mM Ca²⁺ confirm channel activity

    • Channel conductance measurements (approximately 83.7±10.85 pS after adding CaCl₂) help characterize channel properties

  • Reversal potential measurements:

    • Addition of asymmetric Ca²⁺ (100:10 mM) shifts the reversal potential of TMEM41B from 52.77 mV to 13.04 mV

    • This substantial shift indicates Ca²⁺ selectivity of the channel

These methodologies provide complementary data to establish TMEM41B as a bona fide calcium channel and characterize its functional properties.

How does TMEM41B function in primitive endoderm specification?

TMEM41B, together with VMP1, plays a critical role in primitive endoderm (PE) specification during early embryonic development. The mechanistic basis for this function involves:

  • WNT signaling regulation: TMEM41B and VMP1 influence the WNT signaling pathway, which is essential for proper lineage specification in the early embryo . Combined mutation of Vmp1 and Tmem41b leads to deregulation of genes associated with WNT signaling.

  • Receptor trafficking: Cell surface proteome profiling has identified a significant reduction of the WNT receptor FZD2 at the plasma membrane in Vmp1 and Tmem41b double mutant embryonic stem cells (ESCs) . This receptor deficiency appears to be a key mechanism underlying the developmental defects observed.

  • Extra-embryonic endoderm differentiation: ESCs carrying combined mutations in Vmp1 and Tmem41b demonstrate impaired differentiation into primitive endoderm-like cells in culture, and the establishment of extra-embryonic endoderm stem (XEN) cells is delayed .

  • Rescue experiments: Transgenic expression of Fzd2 rescues XEN differentiation in Vmp1/Tmem41b double mutant cells, confirming that the developmental defect is primarily due to reduced WNT receptor expression .

This role in primitive endoderm specification represents a distinct and earlier developmental function of TMEM41B compared to its previously characterized roles in autophagy and lipid metabolism, highlighting the multifunctional nature of this protein.

What is known about the structure-function relationship of TMEM41B's calcium channel activity?

Recent research has begun to elucidate critical structure-function relationships in TMEM41B:

  • Key residues for calcium conductance:

    • Aspartate residues (D91/93/94) facing the ER lumen side are critical for TMEM41B's calcium channel function

    • When these three residues were simultaneously mutated to alanine (D91/93/94A), a partial loss of function in TMEM41B-mediated ER Ca²⁺ release was observed

    • Interestingly, mutation of single negatively charged amino acids (aspartic acid and glutamic acid) did not result in loss of function, suggesting functional redundancy or a coordinated action of multiple residues in calcium conduction

  • Calcium conductance properties:

    • TMEM41B demonstrates calcium selectivity, as evidenced by substantial shifts in reversal potential when exposed to asymmetric calcium concentrations

    • The conductance of TMEM41B increases to 83.7±10.85 pS after adding CaCl₂, indicating that it is a calcium-regulated channel

    • Channel activity manifests as inward step-like signals when calcium is added to the experimental system

  • Functional consequence of mutation:

    • In rescue experiments where wild-type or mutant TMEM41B was re-expressed in TMEM41B-deficient T cells, only the wild-type, but not the D91/93/94A mutant of TMEM41B, reversed CD5 expression and the hyperresponsiveness phenotype

    • This demonstrates that the calcium channel function of TMEM41B, dependent on these specific aspartate residues, is essential for its physiological role in T cell regulation

These findings provide critical insights into the molecular determinants of TMEM41B function and establish a mechanistic basis for its role in calcium homeostasis.

How does TMEM41B interact with the autophagy and lipid metabolism pathways?

TMEM41B serves as a critical node connecting calcium signaling, autophagy, and lipid metabolism:

  • Autophagy regulation:

    • ESCs carrying mutations in Vmp1 and Tmem41b accumulate LC3-positive autophagosomes, indicating defective autophagy progression

    • The mechanism likely involves TMEM41B's lipid scramblase activity, which is essential for proper membrane biogenesis during autophagosome formation

    • TMEM41B may facilitate the transfer of lipids between membrane leaflets, a process necessary for membrane deformation during phagophore expansion

  • Lipid droplet metabolism:

    • TMEM41B-deficient cells show abnormal accumulation of lipid droplets

    • This phenotype suggests that TMEM41B is involved in lipid mobilization from storage organelles

    • The lipid scramblase activity may facilitate proper lipid distribution between cellular compartments

  • Dual functionality:

    • TMEM41B's roles in both calcium signaling and lipid scrambling suggest a potential integration of these processes

    • Calcium flux may regulate lipid scramblase activity or vice versa

    • The shared DedA domain between TMEM41B and VMP1 confers the lipid scramblase function, while the calcium channel activity may depend on specific residues like D91/93/94

  • Developmental consequences:

    • Despite defects in autophagy and lipid metabolism, ESCs with Vmp1 and Tmem41b mutations maintain robust self-renewal and an unperturbed pluripotent expression profile

    • These cells can differentiate into a wide range of embryonic cell types, with a specific defect in primitive endoderm differentiation

This multifunctional nature of TMEM41B positions it as a potential regulatory hub integrating membrane dynamics, calcium signaling, and developmental processes.

How can inconsistent results in TMEM41B functional studies be reconciled?

Researchers may encounter inconsistent or contradictory results when studying TMEM41B. Several methodological approaches can help reconcile these discrepancies:

  • Cell type-specific effects:

    • TMEM41B functions may vary across cell types. For example, its effects on calcium signaling have been observed in T cells, HEK293T cells, and other cell types, but the magnitude of these effects may differ

    • When comparing results across studies, carefully consider the cellular context and evaluate whether cell type-specific factors might influence TMEM41B function

  • Redundancy with VMP1:

    • TMEM41B shares functional overlap with VMP1, particularly in embryonic development and lipid metabolism

    • Single mutations in either gene may be compensated by the other, whereas double mutations reveal stronger phenotypes

    • Consider generating and analyzing both single and double mutants to fully characterize TMEM41B functions

  • Experimental readout sensitivity:

    • Different assays for calcium flux, autophagy, or lipid metabolism vary in sensitivity

    • For calcium measurements, direct assessment of ER Ca²⁺ levels using targeted sensors like G-CEPIA1er may be more sensitive than cytosolic Ca²⁺ measurements

    • Consider employing multiple complementary assays to thoroughly characterize phenotypes

  • Partial vs. complete loss of function:

    • Some mutations may result in partial rather than complete loss of function

    • The D91/93/94A mutation in TMEM41B, for example, causes a partial loss of calcium channel function

    • Careful titration experiments and quantitative analysis of protein function can help characterize the extent of functional impairment

  • Mixed cell populations:

    • In CRISPR-based studies, mixed populations of cells with different mutation status may obscure phenotypes

    • Consider isolating and analyzing monoclonal populations to ensure homogeneous genotypes

What controls should be included when evaluating TMEM41B's role in calcium homeostasis?

Robust experimental design for studying TMEM41B's calcium channel function should include the following controls:

  • Genetic controls:

    • Wild-type cells/animals as negative controls

    • TMEM41B knockout cells/animals as experimental group

    • TMEM41B knockout cells reconstituted with wild-type TMEM41B as rescue controls

    • TMEM41B knockout cells reconstituted with mutant versions (e.g., D91/93/94A) to confirm structure-function relationships

  • Pharmacological controls:

    • Thapsigargin to deplete ER Ca²⁺ stores by inhibiting SERCA pumps

    • EGTA or BAPTA to chelate extracellular or intracellular Ca²⁺, respectively

    • Specific calcium channel blockers to distinguish TMEM41B-mediated calcium flux from other channels

  • Readout controls:

    • Multiple calcium indicators to confirm results (e.g., both Fura-2 for cytosolic Ca²⁺ and G-CEPIA1er for ER Ca²⁺)

    • Calibration standards for quantitative calcium measurements

    • Time-course measurements to capture both immediate and sustained calcium responses

  • Specificity controls:

    • Examine effects on other ion channels or ER proteins to confirm specificity

    • Include positive controls for calcium flux (e.g., ionomycin)

    • Test multiple cell types to determine whether observed effects are generalizable

  • Electrophysiological controls:

    • In bilayer recordings, confirm that observed currents are eliminated by specific mutations (e.g., D91/93/94A)

    • Use asymmetric ion gradients to confirm ion selectivity

    • Demonstrate appropriate current-voltage relationships characteristic of calcium channels

What are the key considerations for designing CRISPR/Cas9 experiments targeting TMEM41B in Xenopus?

When designing CRISPR/Cas9 experiments to study TMEM41B function in Xenopus, researchers should consider:

  • Guide RNA selection criteria:

    • High mutagenic activity: Use computational tools like CRISPRscan to identify efficient guide RNAs

    • Minimal predicted off-target events: Carefully evaluate potential off-target sites

    • High frameshift frequency: Tools like indelphi can predict the likelihood of frameshift mutations

    • Target functionally important domains: For TMEM41B, consider targeting regions encoding the DedA domain or the D91/93/94 residues important for calcium channel function

  • Experimental controls:

    • Include un-injected control embryos

    • Consider including CRISPR controls targeting unrelated genes to distinguish specific from non-specific effects

    • For rescue experiments, include both wild-type and mutant versions of TMEM41B

  • Mutation validation strategies:

    • T7 Endonuclease I assay provides a rapid screen for indel formation

    • Sanger sequencing of the target region confirms the precise nature of mutations

    • RT-PCR spanning multiple exons can detect potential exon skipping events

    • Western blotting confirms loss of protein expression

  • Phenotypic analysis considerations:

    • Analyze multiple developmental stages

    • Employ multiple imaging modalities (e.g., stereomicroscopy, fluorescence microscopy, microCT)

    • Consider molecular phenotyping (e.g., RNA-seq, proteomics) to identify pathway disruptions

    • For calcium signaling studies, adapt calcium imaging techniques for use in Xenopus tissues

  • Xenopus-specific technical considerations:

    • The exon structure of TMEM41B in Xenopus tropicalis and humans is identical, facilitating translational research

    • Consider using transgenic lines (e.g., [Xtr.Tg(tubb2b:GFP)Amaya]) for easier visualization of specific tissues

    • Design primers for genotyping based on Xenopus-specific sequences

    • For phenotypic rescue, use Xenopus TMEM41B mRNA or constructs optimized for Xenopus expression

What are promising areas for future investigation of TMEM41B function?

Several promising research directions could advance our understanding of TMEM41B biology:

  • Structural characterization:

    • Determine the high-resolution structure of TMEM41B using cryo-electron microscopy or X-ray crystallography

    • Map the calcium-conducting pore and identify structural determinants of ion selectivity

    • Characterize conformational changes associated with channel gating

  • Physiological regulators:

    • Identify endogenous modulators of TMEM41B calcium channel activity

    • Investigate whether post-translational modifications regulate channel function

    • Explore potential regulation by ER luminal calcium levels or cytosolic signaling molecules

  • Developmental roles:

    • Further characterize the role of TMEM41B in primitive endoderm specification

    • Investigate potential functions in other developmental transitions

    • Explore species-specific differences in TMEM41B function during development

  • Integration of multiple functions:

    • Determine how TMEM41B's calcium channel and lipid scramblase activities are coordinated

    • Investigate whether these functions are mechanistically linked or independent

    • Identify specific cellular processes that require both activities versus those requiring only one function

  • Therapeutic targeting:

    • Develop specific modulators of TMEM41B channel function

    • Explore potential applications in immunomodulation given its role in T cell responsiveness

    • Investigate links to human diseases associated with calcium dysregulation, autophagy defects, or lipid metabolism disorders

These research directions represent opportunities to deepen our understanding of TMEM41B biology and potentially develop novel therapeutic approaches targeting this multifunctional protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.