Recombinant Xenopus laevis Transmembrane protein 47 (tmem47)

Shipped with Ice Packs
In Stock

Description

Role in Chemoresistance

  • Human Hepatocellular Carcinoma (HCC): TMEM47 overexpression correlates with cisplatin resistance by suppressing caspase-mediated apoptosis and enhancing drug efflux pathways .

  • Breast Cancer: TMEM47 induces tamoxifen resistance in MCF-7 cells, reducing apoptosis rates from 9.68% (control) to 5.00% (overexpression) .

Cell LineApoptosis Rate (Total %)Cisplatin IC50 (μM)Resistance Index
MCF-7 (Control)9.681.58 ± 0.19
TMEM47-OE/MCF-75.003.12 ± 0.322.30
TAMR/MCF-7 (Resistant)3.162.74 ± 0.241.74

Immune Regulation

  • Zebrafish TMEM47: Inhibits interferon (IFN) production during RNA/DNA viral infections by degrading MAVS and STING via autophagy-lysosome pathways. Overexpression increases viral titers by up to 427-fold .

Research Applications

Recombinant Xenopus laevis TMEM47 is utilized in:

  • ELISA Development: Commercial kits (e.g., CBM15’s 50 µg product) enable quantitative detection .

  • Functional Studies: Investigating cell junction dynamics, chemoresistance mechanisms, and viral immune evasion .

  • Comparative Biology: Leveraging evolutionary conservation (82% identity with human TMEM47) to model human diseases .

Challenges and Future Directions

  • Species-Specific Data Gap: Limited direct studies on Xenopus TMEM47 necessitate reliance on ortholog-based extrapolation.

  • Therapeutic Potential: Targeting TMEM47 could reverse chemoresistance in cancers or modulate antiviral responses .

  • Structural Studies: High-resolution crystallography of the recombinant protein could elucidate mechanistic details.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
tmem47; tm4sf10; Transmembrane protein 47; Transmembrane 4 superfamily member 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem47
Target Protein Sequence
MASSASGMEEVRSSVLTPLKLVGLVCIFLALCLDIGAVLSPAWVTADNQYYLSLWESCKK SENRWICDSTLQSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLFAA VVLQVCGLVLYPIKFIETVTLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDYY
Uniprot No.

Target Background

Function
Regulates cell junction organization in epithelial cells. May play a role in the transition from adherens junction to tight junction assembly.
Database Links

KEGG: xla:432211

UniGene: Xl.47108

Protein Families
TMEM47 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell junction, adherens junction.

Q&A

What is TMEM47 and why study it in Xenopus laevis?

TMEM47 (Transmembrane Protein 47) is a protein that plays important roles in regulating the morphology and assembly rate of tight junctions from adherens junctions in vertebrates. It functions by regulating the localization of tight junction proteins . Xenopus laevis serves as an excellent model for studying TMEM47 due to several advantages: its high degree of conservation of cellular and molecular mechanisms with mammals, large and abundant eggs, readily manipulated embryos, and the ease with which large amounts of experimental material can be obtained . The evolutionary conservation of developmental pathways between Xenopus and mammals makes findings potentially translatable to human health applications, particularly given TMEM47's emerging role in cancer research .

How does TMEM47 function differ between Xenopus laevis and Xenopus tropicalis?

While both Xenopus species are valuable research models, their genomic differences impact TMEM47 studies. Xenopus laevis is allotetraploid (resulting from hybridization of two species), containing gene duplicates that can complicate functional studies . In contrast, Xenopus tropicalis has a diploid genome, making it more suitable for genetic approaches to TMEM47 function .

The expression patterns of TMEM47 may show subtle differences between the two species due to their divergence approximately 50 million years ago . For experimental approaches requiring large amounts of protein or tissue samples, X. laevis remains advantageous as it yields approximately five-fold more material per embryo than X. tropicalis . When designing TMEM47 studies, researchers should consider whether genomic simplicity (X. tropicalis) or larger sample size (X. laevis) better suits their research questions.

What are the expression patterns of TMEM47 during Xenopus development?

TMEM47 expression during Xenopus development follows a specific spatiotemporal pattern associated with the formation of cell junctions and epithelial organization. While specific data for TMEM47 in Xenopus is limited in the available literature, the protein's role in tight junction regulation suggests expression in developing epithelial tissues .

Based on comparative studies of junction-associated proteins, TMEM47 expression would be expected to increase during gastrulation and neurulation stages when extensive epithelial remodeling occurs. Researchers can visualize this expression pattern through techniques such as whole-mount in situ hybridization or immunohistochemistry with TMEM47-specific antibodies. For temporal expression analysis, quantitative RT-PCR can be employed across key developmental stages from early cleavage through organogenesis.

How can I clone and express recombinant TMEM47 in Xenopus laevis?

To clone and express recombinant TMEM47 in Xenopus laevis, follow this methodological approach:

  • cDNA Cloning: Isolate total RNA from Xenopus tissues expressing TMEM47, synthesize cDNA, and amplify the TMEM47 open reading frame using specific primers. Alternatively, obtain a TMEM47 clone from resources like the Xenopus Gene Collection (http://xgc.nci.nih.gov)[2].

  • Expression Vector Construction: Clone the TMEM47 sequence into an appropriate expression vector such as a lentiviral ORF clone system. Consider adding a tag (e.g., GFP or mCherry) for visualization and purification purposes .

  • mRNA Synthesis: For oocyte or embryo microinjection, linearize the plasmid and transcribe capped mRNA in vitro using an appropriate RNA polymerase system.

  • Delivery Methods:

    • Microinjection into oocytes (for cell biological studies)

    • Microinjection into early embryos (for developmental studies)

    • Lentiviral transduction into Xenopus cells (for stable expression)

  • Expression Verification: Confirm TMEM47 expression using RT-qPCR, Western blotting, or fluorescence microscopy (if tagged) .

What are the optimal conditions for expressing functional TMEM47 in Xenopus oocytes?

For optimal expression of functional TMEM47 in Xenopus oocytes, consider these critical parameters:

  • Oocyte Selection: Use stage V-VI oocytes from females injected with 50-100 units of pregnant mare serum followed by 600-800 units of human chorionic gonadotropin 12-16 hours before oocyte collection .

  • mRNA Quality: Synthesize capped mRNA with a poly(A) tail to ensure stability and efficient translation. Purify thoroughly to remove any contaminants that could be toxic to oocytes.

  • Injection Parameters:

    • Concentration: 0.1-1.0 μg/μl of TMEM47 mRNA

    • Volume: 20-50 nl per oocyte

    • Injection site: Animal pole or equatorial region depending on experimental goals

  • Incubation Conditions:

    • Temperature: 18°C is optimal for protein expression

    • Medium: OR-2 or modified Barth's solution supplemented with antibiotics

    • Duration: 24-72 hours for full protein expression and membrane incorporation

  • Function Verification: For TMEM47, assess localization to cell junctions through immunostaining or, if fluorescently tagged, direct imaging.

How can I create a TMEM47 knockout or knockdown in Xenopus laevis?

Creating TMEM47 knockout or knockdown in Xenopus laevis can be approached through several methods:

  • Morpholino Oligonucleotide (MO) Knockdown:

    • Design MOs targeting the TMEM47 translation start site or splice junctions

    • Inject 1-20 ng of MO into 1-2 cell stage embryos

    • Include control MOs and rescue experiments with TMEM47 mRNA resistant to MO binding

    • Verify knockdown efficiency by Western blot or RT-qPCR

  • CRISPR/Cas9 Knockout:

    • Design guide RNAs targeting exonic regions of TMEM47

    • Inject Cas9 protein (or mRNA) with guide RNAs into fertilized eggs

    • Screen F0 embryos for mosaic mutations using T7 endonuclease assay or sequencing

    • Raise potential founders to sexual maturity for germline transmission

  • Dominant Negative Approach:

    • Design truncated versions of TMEM47 that interfere with wild-type function

    • Express dominant negative constructs through mRNA injection

    • This approach has historically been successful in Xenopus for functional studies

  • Inducible Systems:

    • Create transgenic lines expressing Cre recombinase under tissue-specific promoters

    • Cross with reporter lines containing floxed TMEM47 alleles

    • This enables conditional inactivation of TMEM47 in specific tissues

Remember that due to the allotetraploid nature of X. laevis, targeting all alleles of TMEM47 may be challenging, potentially necessitating the use of X. tropicalis for complete knockout studies .

What are the best techniques for studying TMEM47 trafficking and localization in Xenopus cells?

To study TMEM47 trafficking and localization in Xenopus cells, employ these methodological approaches:

  • Fluorescent Protein Tagging:

    • Create fusion constructs of TMEM47 with GFP, mCherry, or other fluorescent proteins

    • Express in Xenopus oocytes or embryonic cells via microinjection

    • Monitor localization using confocal or super-resolution microscopy

    • For temporal studies, use time-lapse imaging of developing embryos

  • Immunofluorescence:

    • Generate or obtain antibodies specific to Xenopus TMEM47

    • Fix cells or tissue sections at different developmental stages

    • Perform immunostaining with co-localization markers for cellular compartments

    • Analyze using confocal microscopy to determine subcellular localization

  • Biochemical Fractionation:

    • Homogenize Xenopus tissues expressing recombinant TMEM47

    • Separate cellular components through differential centrifugation

    • Analyze fractions by Western blotting to determine compartment distribution

    • Compare with markers for plasma membrane, tight junctions, and intracellular compartments

  • Live Cell Dynamics:

    • Apply techniques such as fluorescence recovery after photobleaching (FRAP) to assess membrane mobility

    • Use pulse-chase experiments with temperature blocks to track trafficking through secretory pathway

Since TMEM47 functions in regulating tight junction morphology and assembly , co-localization studies with known junction proteins would provide valuable insights into its functional integration within the junctional complex.

How can I assess TMEM47 function in cell adhesion and junction formation in Xenopus embryos?

To assess TMEM47 function in cell adhesion and junction formation in Xenopus embryos:

  • Loss-of-Function Studies:

    • Create TMEM47 knockdowns or knockouts using methods described earlier

    • Analyze embryonic phenotypes, focusing on epithelial integrity, morphogenesis, and tissue boundaries

    • Perform rescue experiments with wild-type or mutant versions of TMEM47

  • Immunohistochemical Analysis:

    • Examine localization of tight junction markers (ZO-1, claudins, occludin) in control versus TMEM47-depleted embryos

    • Assess changes in adherens junction components (cadherins, catenins)

    • Quantify junction length, continuity, and morphology

  • Functional Barrier Assays:

    • Measure transepithelial electrical resistance in explanted epithelia

    • Perform dye penetration assays to assess barrier function

    • Compare wild-type with TMEM47-depleted tissues

  • Live Imaging of Junction Dynamics:

    • Express fluorescently tagged junction proteins in control and TMEM47-knockdown backgrounds

    • Track assembly, disassembly, and remodeling of junctions during morphogenetic events

    • Quantify parameters such as assembly rate, stability, and recovery after disruption

  • Ultrastructural Analysis:

    • Perform transmission electron microscopy to visualize junction ultrastructure

    • Compare tight junction morphology between control and TMEM47-manipulated samples

These approaches will provide complementary insights into TMEM47's functional role in junction biology during Xenopus development.

What protein interaction assays are most effective for studying TMEM47 binding partners in Xenopus?

For studying TMEM47 binding partners in Xenopus, these protein interaction assays are most effective:

  • Co-Immunoprecipitation (Co-IP):

    • Express tagged TMEM47 in Xenopus embryos or oocytes

    • Prepare lysates under conditions that preserve protein-protein interactions

    • Immunoprecipitate TMEM47 complexes using antibodies against the tag

    • Identify binding partners through mass spectrometry or Western blotting

    • Verify interactions with reciprocal Co-IPs

  • Proximity Labeling:

    • Create fusion constructs of TMEM47 with BioID or APEX2

    • Express in Xenopus cells to biotinylate proteins in close proximity

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach is particularly valuable for transmembrane proteins like TMEM47

  • Yeast Two-Hybrid Screening:

    • Use cytoplasmic domains of TMEM47 as bait

    • Screen against Xenopus cDNA libraries

    • Validate hits using other interaction assays

  • Pull-down Assays:

    • Express GST or His-tagged domains of TMEM47

    • Incubate with Xenopus embryo or oocyte lysates

    • Identify binding partners through Western blotting or mass spectrometry

  • Fluorescence Resonance Energy Transfer (FRET):

    • Create donor-acceptor pairs with TMEM47 and candidate partners

    • Express in Xenopus cells and measure energy transfer

    • Provides spatial information about interactions in living cells

The Xenopus system offers unique advantages for these studies, including the ability to obtain large amounts of material for biochemical approaches and the possibility to study interactions in developmental contexts .

How should I interpret contradictory results between TMEM47 studies in Xenopus and mammalian systems?

When faced with contradictory results between TMEM47 studies in Xenopus and mammalian systems, consider these analytical approaches:

  • Evolutionary Divergence Analysis:

    • Compare protein sequences of TMEM47 across species to identify conserved and divergent domains

    • Differences in specific domains may explain functional variations

    • Use phylogenetic analysis to trace evolutionary changes

  • Expression Context Differences:

    • Examine expression patterns in both systems

    • Different tissue contexts may lead to different protein interactions and functions

    • TMEM47 has diverse roles in different cancers (e.g., overexpressed in metastatic breast cancer but acts as a tumor suppressor in melanoma)

  • Methodological Considerations:

    • Evaluate differences in experimental approaches

    • Overexpression versus knockdown may produce seemingly contradictory results

    • Compare acute versus chronic manipulations of TMEM47 levels

  • Developmental Stage Variations:

    • Analyze whether studies were conducted at comparable developmental stages

    • TMEM47 function may change during development as cellular junctions mature

  • Reconciliation Framework:

    • Develop testable hypotheses that could explain apparent contradictions

    • Design experiments specifically to address discrepancies

    • Consider that both results may be valid in different contexts

The allotetraploid nature of Xenopus laevis may also contribute to functional redundancy that masks phenotypes seen in mammalian systems . Direct comparison experiments using the same methodologies in both systems can help resolve contradictions.

What statistical approaches are most appropriate for analyzing TMEM47 expression data in Xenopus developmental studies?

For analyzing TMEM47 expression data in Xenopus developmental studies, these statistical approaches are most appropriate:

  • Time-Series Analysis:

    • For developmental expression profiles:

      • Use repeated measures ANOVA for comparing expression across multiple stages

      • Apply time-series regression models to identify significant trends

      • Consider non-linear regression for fitting developmental expression curves

  • Spatial Expression Analysis:

    • For in situ hybridization or immunohistochemistry data:

      • Use image analysis software to quantify signal intensity

      • Apply spatial statistics to analyze expression patterns

      • Consider clustering algorithms to identify co-expressed genes

  • Differential Expression Analysis:

    • When comparing experimental conditions:

      • Use t-tests for pairwise comparisons or ANOVA for multiple conditions

      • Apply FDR correction for multiple hypothesis testing

      • Consider fold-change thresholds in addition to p-values

  • Sample Size Considerations:

    • Power analysis to determine appropriate sample sizes:

      • For qPCR studies: minimum n=3-5 biological replicates

      • For imaging studies: 10-30 embryos per condition

      • For RNA-seq: 3-4 biological replicates per condition

  • Data Visualization:

    • Heat maps for spatiotemporal expression patterns

    • Box plots to show expression variability across conditions

    • Line graphs with error bars for temporal expression trends

When working with the allotetraploid Xenopus laevis, consider analyzing paralogs separately before combining data, as expression patterns may differ between duplicated genes .

How can I determine if TMEM47 expression changes are causative or correlative in Xenopus phenotypic studies?

To determine if TMEM47 expression changes are causative or correlative in Xenopus phenotypic studies:

  • Rescue Experiments:

    • After TMEM47 knockdown or knockout, reintroduce wild-type or mutant versions

    • Quantify the degree of phenotypic rescue

    • Partial rescue may indicate redundant or compensatory mechanisms

  • Dose-Response Relationships:

    • Create a gradient of TMEM47 expression levels

    • Correlate expression levels with phenotypic severity

    • A clear dose-response relationship strengthens causative arguments

  • Temporal Control Experiments:

    • Use inducible systems like hormone-responsive promoters or Cre/loxP systems

    • Manipulate TMEM47 at different developmental stages

    • Identify critical time windows when TMEM47 function is required

  • Pathway Analysis:

    • Perform epistasis experiments by manipulating downstream effectors

    • If manipulating downstream components bypasses the need for TMEM47, this suggests causality

    • Map the sequence of molecular events following TMEM47 manipulation

  • Structure-Function Analysis:

    • Create domain-specific mutants of TMEM47

    • Correlate specific molecular functions with phenotypic outcomes

    • This links specific biochemical activities to biological phenomena

These approaches collectively strengthen causal inferences about TMEM47 function in Xenopus development beyond simple correlative observations.

How can TMEM47 studies in Xenopus inform our understanding of its role in human disease?

TMEM47 studies in Xenopus can inform our understanding of human disease through several translational approaches:

  • Cancer Biology Connections:

    • TMEM47 is implicated in chemoresistance in hepatocellular carcinoma (HCC)

    • Xenopus studies can reveal fundamental mechanisms of TMEM47 function in cell adhesion and migration

    • These insights may explain TMEM47's contrasting roles in different cancers (promoting aggression in breast cancer while acting as a tumor suppressor in melanoma)

  • Developmental Disease Modeling:

    • Use Xenopus to model human developmental disorders associated with cell junction defects

    • TMEM47 manipulation can reveal how junction assembly impacts organ formation

    • Parallels between Xenopus phenotypes and human congenital disorders may identify TMEM47 as a candidate gene

  • Drug Discovery Pipeline:

    • Screen for compounds that modify TMEM47 function in Xenopus embryos

    • Promising candidates can be tested for their ability to overcome chemoresistance

    • As TMEM47 upregulation correlates with poor response to cisplatin-based treatment in HCC patients , Xenopus screens could identify sensitizing agents

  • Comparative Functional Genomics:

    • Compare function of Xenopus TMEM47 with human orthologs

    • Express disease-associated human TMEM47 variants in Xenopus to assess functional consequences

    • Use these insights to classify human TMEM47 variants of unknown significance

The conservation of cellular and molecular mechanisms between Xenopus and humans makes these translational approaches feasible and potentially high-impact .

What role might TMEM47 play in epithelial-mesenchymal transition during Xenopus development?

TMEM47 likely plays a significant role in epithelial-mesenchymal transition (EMT) during Xenopus development through these mechanisms:

  • Junction Regulation During EMT:

    • TMEM47 regulates tight junction morphology and assembly

    • During EMT, tight junctions must be disassembled in a controlled manner

    • TMEM47 may function as a critical regulator of this disassembly process

  • TMEM47 Expression Dynamics:

    • Expected expression pattern changes during key EMT events:

      • Downregulation during neural crest EMT

      • Modulation during mesoderm involution during gastrulation

      • Re-expression during mesenchymal-epithelial transition (MET)

  • Cancer Metastasis Connection:

    • TMEM47 is overexpressed in metastatic breast cancer cells

    • Metastasis involves EMT-like processes

    • Xenopus studies can reveal how TMEM47 contributes to cell invasiveness and migration

  • Signaling Pathway Integration:

    • TMEM47 may interact with EMT master regulators such as Snail, Slug, or Twist

    • It could modulate Wnt, TGF-β, or FGF signaling, all of which drive EMT in Xenopus

    • The large-scale embryological manipulations possible in Xenopus make it ideal for dissecting these interactions

  • Experimental Approach:

    • Examine TMEM47 localization during natural EMT events

    • Manipulate TMEM47 levels specifically in EMT-undergoing tissues

    • Assess effects on EMT markers and cell behavior

Understanding TMEM47's role in developmental EMT may provide insights into its function in cancer progression and metastasis, given the parallels between these processes.

How can I integrate omics approaches to comprehensively characterize TMEM47 function in Xenopus?

To comprehensively characterize TMEM47 function in Xenopus using integrated omics approaches:

  • Multi-omics Experimental Design:

    • Generate TMEM47 knockdown or knockout Xenopus embryos

    • Collect samples at key developmental stages

    • Perform parallel analyses using multiple omics technologies

    • Include appropriate controls and biological replicates

  • Transcriptomics:

    • Conduct RNA-seq on TMEM47-manipulated versus control embryos

    • Identify differentially expressed genes and enriched pathways

    • Perform spatial transcriptomics to reveal tissue-specific responses

  • Proteomics:

    • Use mass spectrometry to identify proteome-wide changes

    • Apply proximity labeling (BioID/APEX2) to map TMEM47 protein interaction network

    • Perform phosphoproteomics to identify signaling pathways affected by TMEM47

  • Metabolomics:

    • Characterize metabolic changes in TMEM47-deficient embryos

    • Look for signatures related to cell junction function and epithelial biology

  • Chromatin Biology:

    • Perform ChIP-seq for histone modifications to identify epigenetic changes

    • Map chromatin accessibility changes using ATAC-seq

    • These approaches can reveal how TMEM47 manipulation affects gene regulation

  • Data Integration Framework:

    • Use computational approaches to integrate multi-omics data:

      • Network analysis to identify regulatory hubs

      • Pathway enrichment across multiple data types

      • Machine learning to identify predictive biomarkers of TMEM47 function

  • Validation Strategy:

    • Select key findings for functional validation

    • Use the experimental versatility of Xenopus to test hypotheses generated from omics data

    • Create a feedback loop between data generation and experimental validation

The large size and abundance of Xenopus embryos make them particularly suitable for multi-omics approaches, as sufficient material can be obtained for multiple analyses from the same experimental batch .

How can recombinant TMEM47 be used to study drug resistance mechanisms in Xenopus cancer models?

Recombinant TMEM47 can be used to study drug resistance mechanisms in Xenopus cancer models through these methodological approaches:

  • Xenopus-Based Cancer Models:

    • Create tadpole cancer models through targeted oncogene expression

    • Express human or Xenopus TMEM47 at varying levels

    • These models can be rapidly generated and easily visualized due to the transparent nature of tadpoles

  • TMEM47 Overexpression Studies:

    • Express recombinant TMEM47 in Xenopus cells or embryos

    • Treat with chemotherapeutic agents such as cisplatin

    • Measure survival, proliferation, and apoptotic responses

    • This approach mirrors the observed upregulation of TMEM47 in chemoresistant HCC cells

  • Mechanistic Investigations:

    • Examine effects of TMEM47 expression on:

      • Drug efflux (expression of MDR transporters)

      • DNA damage repair pathways

      • Apoptotic threshold

      • Cellular metabolism

    • TMEM47 has been shown to suppress cisplatin-induced activation of genes involved in drug efflux and metabolism in human cancer cells

  • Combination Therapy Screening:

    • Express TMEM47 in Xenopus models

    • Screen for compounds that sensitize TMEM47-expressing cells to chemotherapy

    • The rapid development and large numbers of Xenopus embryos enable medium-throughput screening

  • Drug Resistance Reversal:

    • Develop TMEM47 inhibition strategies (e.g., morpholinos, dominant negatives)

    • Test their ability to restore chemosensitivity

    • This builds on findings that TMEM47 inhibition enhances caspase-mediated apoptosis in response to cisplatin

This approach leverages the correlation between TMEM47 expression and poor response to cisplatin-based treatment observed in HCC patients, providing a translational dimension to basic Xenopus research .

What are the key considerations for developing TMEM47 antibodies for Xenopus research?

Developing effective TMEM47 antibodies for Xenopus research requires these key considerations:

  • Antigen Design Strategy:

    • Compare Xenopus TMEM47 sequence with other species

    • Select unique, conserved, or functionally important epitopes

    • Options include:

      • Synthetic peptides from extracellular or cytoplasmic domains

      • Recombinant protein fragments

      • Full-length TMEM47 expressed in heterologous systems

  • Cross-Reactivity Considerations:

    • Address potential cross-reactivity with:

      • TMEM47 paralogs in the allotetraploid X. laevis genome

      • Other TMEM family members

      • Perform thorough validation using TMEM47 knockdown controls

  • Applications-Based Development:

    • For immunohistochemistry: Target extracellular domains or use fixation-resistant epitopes

    • For Western blotting: Target denaturation-resistant linear epitopes

    • For immunoprecipitation: Select antibodies with high affinity in native conditions

  • Validation Parameters:

    • Specificity: Test on TMEM47-overexpressing and TMEM47-knockdown samples

    • Sensitivity: Determine minimum detectable concentration

    • Cross-species reactivity: Test with human TMEM47 for translational studies

    • Background: Optimize to minimize non-specific binding

  • Production Format Selection:

    • Monoclonal: For consistent supply and single epitope recognition

    • Polyclonal: For robust detection of multiple epitopes

    • Recombinant antibodies: For reproducibility and reduced batch variation

Given the importance of TMEM47 in junction biology and its emerging role in cancer , developing specific antibodies is crucial for advancing research in both developmental and disease contexts.

How can I optimize lentiviral expression systems for TMEM47 studies in Xenopus cells?

To optimize lentiviral expression systems for TMEM47 studies in Xenopus cells:

  • Vector Design Considerations:

    • Select appropriate promoters:

      • CMV or CAG for strong, ubiquitous expression

      • Tissue-specific promoters for targeted studies

      • Inducible promoters for temporal control

    • Include selectable markers (fluorescent proteins or antibiotic resistance)

    • Consider including epitope tags for detection and purification

  • Optimization Parameters for Xenopus Cells:

    • Viral titer: Typically requires higher MOI for Xenopus cells compared to mammalian cells

    • Transduction enhancers: Test polybrene, protamine sulfate, or centrifugation

    • Temperature: Optimize between room temperature and 30°C for Xenopus cell transduction

    • Duration: Allow longer incubation times (24-48 hours) for effective transduction

  • Lentiviral Particle Production:

    • Use third-generation packaging systems for enhanced safety

    • Produce in 293 cells as described in reference materials

    • Concentrate viral particles for higher efficiency in Xenopus cells

    • Test freshly prepared versus frozen viral stocks

  • Expression Verification Strategy:

    • Monitor expression using:

      • Fluorescent reporters (direct visualization)

      • RT-qPCR for mRNA expression levels

      • Western blotting for protein expression

      • Functional assays specific to TMEM47

  • Experimental Applications:

    • For in vitro studies: Directly transduce Xenopus cell lines or primary cultures

    • For in vivo studies:

      • Inject viral particles into specific tissues of tadpoles

      • Create transgenic lines by transducing early embryos

This optimization leverages the established methods for lentiviral transduction described in the literature while adapting them specifically for the Xenopus system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.