Recombinant Xenopus laevis Transmembrane protein 53-A (tmem53-a)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Xenopus laevis Transmembrane protein 53-A (Tmem53-A), is a protein that, in Xenopus laevis (African clawed frog), is encoded by the gene tmem53-a . It is a full-length protein, fused to an N-terminal His tag, and expressed in E. coli .

Table 1: Key Features of Recombinant Xenopus laevis Tmem53-A Protein

FeatureDescription
SpeciesXenopus laevis
SourceE. coli
TagHis
Protein LengthFull Length (1-285 amino acids)
UniProt IDQ5PPS7
Synonymstmem53-a; Transmembrane protein 53-A
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0 or Tris-based buffer, 50% glycerol, optimized for this protein
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles; or Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended.
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .
Amino Acid SequenceMGDSELDYTIEFPEPSLQGWPWDPEREPVVILLGWGGCKDHYLAKYSAIYHNQGCTVIKYTAAWKAVFITESLGLNSLREDAKKLLELLFDYEIEKSPIVFHVFSNGGFMLYRYIVELLHSHCPLNKLHVVGTIFDSAPGNRNVIGSVRALDTILRTSTNKAFRFLALAAFAILVIILRILLYPLTRFLHENHYDAMKKDPSRWPQLYLYSRADPIISYLDVESMIAARRRRCLPTETLDFGKSEHVSHFRRFPQRYSEICTSFLRDCVRKASISMLRSEHPVSF

Gene Information

The gene name for Transmembrane protein 53-A is tmem53-a . In humans, deficiency of TMEM53 can cause sclerosing bone disorder by dysregulation of BMP-SMAD signaling .

Function and Pathways

Tmem53-a is involved in several pathways and has different biochemical functions, some of which are cooperated with other proteins, while others are acted on by tmem53-a itself . TMEM53 negatively regulates bone morphogenetic protein (BMP) signaling in osteoblast lineage cells by blocking cytoplasm-nucleus translocation of phosphorylated .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
tmem53-a; Transmembrane protein 53-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem53-a
Target Protein Sequence
MGDSELDYTIEFPEPSLQGWPWDPEREPVVILLGWGGCKDHYLAKYSAIYHNQGCTVIKY TAAWKAVFITESLGLNSLREDAKKLLELLFDYEIEKSPIVFHVFSNGGFMLYRYIVELLH SHCPLNKLHVVGTIFDSAPGNRNVIGSVRALDTILRTSTNKAFRFLALAAFAILVIILRI LLYPLTRFLHENHYDAMKKDPSRWPQLYLYSRADPIISYLDVESMIAARRRRCLPTETLD FGKSEHVSHFRRFPQRYSEICTSFLRDCVRKASISMLRSEHPVSF
Uniprot No.

Target Background

Database Links

KEGG: xla:496092

UniGene: Xl.7797

Protein Families
TMEM53 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is TMEM53-A and what is its significance in Xenopus laevis research?

TMEM53-A is a transmembrane protein localized to the outer nuclear membrane (ONM) in Xenopus laevis. Based on comparative data, TMEM53 is highly conserved among species, with approximately 86.3% sequence identity between human and mouse homologs . In vertebrate models, TMEM53 functions as a regulatory protein involved in BMP-SMAD signaling pathways by preventing excessive nuclear accumulation of phosphorylated SMAD1/5/9 transcription factors .

Given that Xenopus laevis is a model of choice for evolutionary, comparative, and developmental studies, the recombinant TMEM53-A protein provides researchers with a valuable tool to investigate the conservation and divergence of nuclear envelope protein functions across species . The high degree of similarity between Xenopus and mammalian systems makes this protein particularly valuable for translational research approaches.

How does the amino acid sequence of Xenopus laevis TMEM53-A compare with mammalian orthologs?

While the search results don't provide the specific sequence for Xenopus laevis TMEM53-A, we can infer its likely conservation based on comparative data between other species. TMEM53 exhibits high conservation across vertebrates, with human and mouse TMEM53 showing 86.3% amino acid identity .

This conservation suggests that Xenopus laevis TMEM53-A likely shares significant sequence similarity with its mammalian counterparts, particularly in functional domains such as the transmembrane region. As a reference point, another Xenopus laevis transmembrane protein (TMEM163) consists of 281 amino acids with a specific sequence pattern that includes a transmembrane domain critical for its localization and function .

What expression systems are recommended for producing recombinant Xenopus laevis TMEM53-A?

Based on established protocols for similar Xenopus laevis transmembrane proteins, E. coli expression systems have proven effective for recombinant protein production . When expressing Xenopus laevis TMEM53-A, researchers should consider the following methodological approaches:

  • Vector selection: Plasmids containing N-terminal or C-terminal His-tags facilitate purification while minimizing interference with protein function

  • Expression conditions: Induction at lower temperatures (16-18°C) may improve proper folding of transmembrane proteins

  • Solubilization strategies: Detergent selection is critical; mild non-ionic detergents often preserve transmembrane protein structure

  • Purification approach: Immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography

For functional studies where proper folding and post-translational modifications are essential, researchers might consider eukaryotic expression systems such as insect cells (Sf9/Sf21) or mammalian cell lines as alternatives to E. coli.

What methodologies are recommended for studying TMEM53-A localization in Xenopus cells?

To investigate the subcellular localization of TMEM53-A in Xenopus cells, researchers should employ a multi-faceted approach:

  • Immunocytochemistry (ICC): Using antibodies against TMEM53-A or epitope tags, researchers can visualize protein localization through confocal microscopy. Co-staining with nuclear envelope markers (e.g., lamin B1, SUN proteins) can confirm outer nuclear membrane localization .

  • Subcellular fractionation: Separate nuclear envelope, nuclear, and cytoplasmic fractions through differential centrifugation, followed by Western blot analysis to detect TMEM53-A in specific cellular compartments.

  • Proximity labeling approaches: BioID or APEX2 fusion proteins can identify proteins in close proximity to TMEM53-A, providing insights into its functional localization.

  • Live-cell imaging: Express fluorescently-tagged TMEM53-A in Xenopus cells to monitor its dynamic localization during development or in response to stimuli.

These methods should be complemented with appropriate controls to validate specificity, including knockdown/knockout approaches to confirm antibody specificity .

How can researchers investigate the role of TMEM53-A in BMP signaling pathways in Xenopus laevis?

Based on mammalian studies, TMEM53 regulates BMP signaling by controlling the nuclear localization of phosphorylated SMAD1/5/9 . To investigate this function in Xenopus laevis, researchers should consider these methodological approaches:

  • Nucleocytoplasmic distribution analysis:

    • Perform immunocytochemistry for phosphorylated SMAD1/5/9 in control versus TMEM53-A-depleted cells

    • Quantify the nuclear-to-cytoplasmic ratio of phosphorylated SMAD1/5/9 following BMP stimulation

    • Compare Western blot results of nuclear and cytoplasmic fractions

  • Transcriptional activity assays:

    • Employ BMP-responsive luciferase reporter constructs to measure pathway activity

    • Analyze expression of known BMP target genes by qRT-PCR

    • Perform RNA-seq to identify global transcriptional changes

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to detect physical interactions between TMEM53-A and components of the BMP pathway

    • Proximity ligation assays to visualize interactions in situ

  • Developmental phenotype analysis:

    • Morpholino-mediated knockdown of TMEM53-A during early development

    • CRISPR/Cas9-mediated mutation of TMEM53-A

    • Rescue experiments with wild-type versus mutant TMEM53-A

What phenotypes would be expected from TMEM53-A knockdown or knockout in Xenopus laevis?

Based on studies of TMEM53 deficiency in humans and mice, researchers might expect the following phenotypes when TMEM53-A function is disrupted in Xenopus laevis:

  • Developmental abnormalities:

    • Normal development until later stages (equivalent to the late-onset phenotypes observed in mouse models)

    • Craniofacial abnormalities including altered head shape and potential hypertelorism

    • Shortened body length in tadpoles or metamorphosed frogs

  • Skeletal alterations:

    • Thickening of cartilaginous structures (analogous to calvaria thickening in mice)

    • Altered vertebral development, potentially including flattened vertebral bodies

    • Changes in limb development during and after metamorphosis

  • Cellular and molecular changes:

    • Enhanced osteoblast differentiation in relevant tissues

    • Increased nuclear localization of phosphorylated SMAD1/5/9

    • Upregulation of BMP target genes in affected tissues

  • Functional consequences:

    • Potential impact on swimming behavior due to skeletal abnormalities

    • Possible sensory deficits analogous to vision impairment observed in human patients

Documentation of these phenotypes should include careful staging, morphometric analysis, histological examination, and molecular profiling.

How can TMEM53-A function in Xenopus laevis be compared with its function in mammalian systems?

For comparative functional analysis between Xenopus TMEM53-A and mammalian TMEM53, researchers should implement these methodological approaches:

  • Rescue experiments:

    • Test if human or mouse TMEM53 can rescue phenotypes resulting from Xenopus TMEM53-A knockdown/knockout

    • Test if Xenopus TMEM53-A can restore normal function in TMEM53-deficient mammalian cells

    • Generate chimeric proteins to identify functionally conserved domains

  • Comparative protein interaction studies:

    • Perform parallel co-immunoprecipitation studies in Xenopus and mammalian cells

    • Use BioID or APEX2 proximity labeling to identify interactors across species

    • Compare the ability of Xenopus TMEM53-A and mammalian TMEM53 to interact with components of the nuclear pore complex

  • Evolutionary functional assessment:

    • Generate a TMEM53 phylogenetic tree across vertebrates to identify conserved functional domains

    • Perform domain-swapping experiments between species

    • Analyze sites under purifying versus positive selection

  • Comparative developmental phenotyping:

    • Document developmental timing differences in phenotype manifestation between species

    • Analyze tissue-specific expression patterns across species using RNA-seq data

    • Compare transcriptional responses to TMEM53 modulation across species

What structural features of recombinant TMEM53-A are critical for its function at the nuclear envelope?

Understanding the structural determinants of TMEM53-A function requires detailed analysis of its domains and their relationships to cellular localization and signaling regulation:

  • Transmembrane domain analysis:

    • The transmembrane domain is essential for proper localization to the nuclear envelope

    • Truncated versions of TMEM53 lacking the transmembrane domain fail to rescue signaling defects in knockout cells

    • Site-directed mutagenesis of conserved residues within this domain can identify critical anchoring motifs

  • Functional domain mapping:

    • Generate truncation mutants to identify regions required for SMAD1/5/9 regulation

    • Create point mutations in conserved residues to identify those critical for function

    • Perform structure-function analyses using chimeric constructs with other nuclear envelope proteins

  • Post-translational modification analysis:

    • Identify phosphorylation, ubiquitination, or other modifications that might regulate TMEM53-A function

    • Perform site-directed mutagenesis of potential modification sites

    • Test if modifications change in response to BMP pathway activation

  • Structural analysis techniques:

    • Circular dichroism to assess secondary structure composition

    • Limited proteolysis to identify stable domains

    • If possible, X-ray crystallography or cryo-EM of purified protein or relevant domains

How can researchers differentiate between direct and indirect effects of TMEM53-A on BMP signaling?

Distinguishing direct from indirect effects of TMEM53-A on BMP signaling requires careful experimental design:

  • Temporal resolution studies:

    • Perform time-course analyses after acute depletion of TMEM53-A (e.g., using auxin-inducible degron systems)

    • Compare immediate versus delayed transcriptional responses using RNA-seq

    • Track phosphorylated SMAD1/5/9 localization dynamics at short time intervals after TMEM53-A depletion

  • Direct interaction assessment:

    • Test for physical interactions between TMEM53-A and SMAD proteins or nuclear pore complex components

    • Perform in vitro binding assays using purified components

    • Use FRET or BRET approaches to detect interactions in living cells

  • Reconstitution experiments:

    • Develop in vitro nuclear transport assays using isolated nuclei

    • Test if addition of purified TMEM53-A alters nuclear transport of phosphorylated SMAD1/5/9

    • Reconstruct minimal systems using defined components

  • Alternative pathway analysis:

    • Examine effects on other signaling pathways (e.g., TGF-β, Wnt, Hedgehog)

    • Test if TMEM53-A effects depend on intact BMP receptor signaling

    • Perform epistasis experiments by modulating upstream or downstream pathway components

What are the optimal storage and handling conditions for recombinant Xenopus laevis TMEM53-A protein?

Based on established protocols for similar transmembrane proteins from Xenopus laevis, researchers should follow these guidelines:

  • Storage recommendations:

    • Store lyophilized protein at -20°C to -80°C for long-term stability

    • For working aliquots, store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles that can denature the protein

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% for improved stability

    • Prepare small single-use aliquots for long-term storage

  • Buffer considerations:

    • Optimal buffer systems include Tris/PBS-based buffers at pH 8.0

    • Consider adding stabilizing agents such as 6% Trehalose

    • For functional studies, ensure buffer composition maintains native protein conformation

  • Quality control measures:

    • Verify protein purity using SDS-PAGE (target >90% purity)

    • Confirm identity via Western blot analysis

    • Test functional activity using established assays

What approaches can be used to overcome challenges in expressing full-length TMEM53-A with proper folding?

Transmembrane proteins present unique challenges for recombinant expression. Researchers working with TMEM53-A should consider:

  • Expression system optimization:

    • Compare prokaryotic (E. coli) versus eukaryotic (insect or mammalian) expression systems

    • Test different E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Optimize induction conditions (temperature, inducer concentration, duration)

  • Solubilization strategies:

    • Screen detergent panels to identify optimal solubilization conditions

    • Consider nanodiscs or amphipols for maintaining native conformation

    • Test different lysis methods to improve extraction efficiency

  • Fusion tags and constructs:

    • Compare N-terminal versus C-terminal His-tags

    • Test additional solubility-enhancing tags (MBP, SUMO, Trx)

    • Consider expressing functional domains separately if full-length expression is problematic

  • Protein quality assessment:

    • Evaluate proper folding using circular dichroism or limited proteolysis

    • Perform functional assays to verify activity

    • Assess aggregation state using size exclusion chromatography or dynamic light scattering

How can researchers validate the specificity of antibodies for detecting Xenopus laevis TMEM53-A?

Ensuring antibody specificity is critical for accurate interpretation of TMEM53-A studies. Researchers should implement these validation strategies:

  • Genetic validation approaches:

    • Test antibody reactivity in TMEM53-A knockout or knockdown samples

    • Overexpress tagged TMEM53-A and confirm co-localization with antibody signal

    • Compare staining patterns across tissues with known expression patterns from RNA-seq data

  • Biochemical validation:

    • Perform Western blots to confirm single bands of appropriate molecular weight

    • Conduct peptide competition assays to demonstrate specific binding

    • Pre-absorb antibodies with recombinant protein to eliminate specific signal

  • Cross-reactivity assessment:

    • Test antibodies against related proteins (e.g., other TMEM family members)

    • Compare multiple antibodies targeting different epitopes

    • Validate in multiple experimental contexts (ICC, WB, IP)

  • Functional validation:

    • Confirm that antibody-detected signals change as expected with experimental manipulation

    • Demonstrate appropriate subcellular localization consistent with protein function

    • Verify changes in expression or localization under conditions known to affect the protein

What technical considerations are important when designing CRISPR/Cas9 targeting strategies for TMEM53-A modification?

For successful CRISPR/Cas9-mediated modification of TMEM53-A in Xenopus laevis, researchers should consider:

  • Target site selection:

    • Design guide RNAs targeting early exons shared across all transcripts to ensure complete knockout

    • Target conserved functional domains when creating specific mutations

    • Avoid regions with high GC content or secondary structure that might impair Cas9 access

    • Screen multiple guide RNAs to identify those with highest efficiency

  • Allotetraploidy considerations:

    • Account for Xenopus laevis allotetraploidy when designing guides

    • Ensure targeting of both homeologs (TMEM53-A.L and TMEM53-A.S) if complete knockout is desired

    • Design primers that distinguish between homeologs for validation

  • Delivery methods:

    • Optimize microinjection parameters for delivering Cas9/gRNA into fertilized eggs

    • Consider using Cas9 protein with in vitro transcribed gRNAs for highest efficiency

    • Implement appropriate controls to assess injection success and embryo viability

  • Validation strategies:

    • Design PCR primers flanking the target site for initial screening

    • Perform sequencing to confirm mutations and characterize indel patterns

    • Validate at protein level using Western blot or immunostaining

    • Perform functional assays to confirm altered BMP signaling

How can TMEM53-A research in Xenopus laevis contribute to understanding human skeletal disorders?

Research on TMEM53-A in Xenopus laevis offers valuable insights into human skeletal disorders, particularly sclerosing bone dysplasias (SBDs):

  • Comparative disease modeling:

    • TMEM53 mutations in humans cause a previously unknown type of SBD with distinctive skeletal features

    • Xenopus models can help elucidate developmental mechanisms underlying these disorders

    • The conservation of TMEM53 across species suggests functional relevance to human pathology

  • Developmental timing insights:

    • Xenopus allows precise developmental staging to determine when TMEM53-A dysfunction first impacts development

    • The transparent nature of Xenopus embryos enables real-time visualization of skeletal development

    • Late-onset phenotypes observed in human patients can be studied in the context of metamorphosis

  • Signaling pathway analysis:

    • BMP signaling dysregulation contributes to human skeletal disorders

    • Xenopus models can reveal how TMEM53-A modulates this pathway during normal development

    • Pharmacological interventions targeting BMP signaling can be tested in Xenopus

  • Therapeutic strategy development:

    • Rescue experiments in Xenopus can identify potentially therapeutic interventions

    • Drug screening platforms using Xenopus embryos can identify compounds that normalize BMP signaling

    • Gene therapy approaches can be preliminarily tested in this model system

What approaches can be used to investigate potential redundancy between TMEM53-A and other nuclear envelope proteins?

Investigating functional redundancy requires systematic analysis of related proteins:

  • Comparative expression analysis:

    • Perform RNA-seq to identify co-expressed nuclear envelope proteins across developmental stages

    • Use single-cell transcriptomics to map expression at cellular resolution

    • Compare protein localization patterns through immunostaining of multiple nuclear envelope proteins

  • Combined depletion strategies:

    • Generate single versus double/triple knockouts to identify synthetic phenotypes

    • Perform combinatorial knockdown using morpholinos or RNAi

    • Use graded depletion approaches to identify threshold effects

  • Domain-based comparative analysis:

    • Identify proteins with similar functional domains to TMEM53-A

    • Test if these related proteins can rescue TMEM53-A depletion phenotypes

    • Perform domain-swapping experiments to identify functionally equivalent regions

  • Evolutionary analysis:

    • Compare nuclear envelope proteomes across species to identify TMEM53-A paralogs

    • Analyze selective pressure on different nuclear envelope proteins

    • Reconstruct evolutionary history of gene duplications and losses

How might TMEM53-A function change during Xenopus metamorphosis?

Xenopus metamorphosis represents a unique developmental transition with profound tissue remodeling, offering an excellent context to study TMEM53-A function:

  • Expression analysis during metamorphosis:

    • Perform stage-specific qRT-PCR and Western blotting to track TMEM53-A expression levels

    • Use in situ hybridization to map spatial expression patterns in metamorphosing tissues

    • Compare expression with other nuclear envelope proteins during this transition

  • Thyroid hormone responsiveness:

    • Analyze TMEM53-A promoter for thyroid hormone response elements

    • Test if TMEM53-A expression changes in response to exogenous T3/T4

    • Compare expression in control versus thyroid hormone receptor-mutant animals

  • Functional studies across metamorphosis:

    • Generate temperature-sensitive or inducible TMEM53-A mutants to control timing of dysfunction

    • Compare pre-metamorphic versus post-metamorphic phenotypes in TMEM53-A mutants

    • Analyze BMP signaling dynamics before, during, and after metamorphosis in normal versus mutant animals

  • Tissue-specific functions:

    • Perform tissue-specific knockdown using targeted CRISPR approaches

    • Analyze differential effects on resorbing versus remodeling versus newly forming tissues

    • Compare effects on different ossification modes (intramembranous versus endochondral)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.