Recombinant Xenopus laevis Transmembrane protein 53-B (tmem53-b)

Shipped with Ice Packs
In Stock

Description

Xenopus laevis and TMEM53

Xenopus laevis, also known as the African clawed frog, is a widely used model organism in biological research, particularly in developmental biology . TMEM53, or Transmembrane protein 53, is a protein that, in humans, is encoded by the TMEM53 gene . It is also known as NET4 (Nuclear Envelope Transmembrane protein 4) . TMEM53 has been identified as a nuclear envelope protein .

TMEM53 Function and Research

Research suggests that TMEM53 plays a role in regulating bone formation and development by acting as an inhibitor of BMP-SMAD signaling .

  • BMP-SMAD Signaling: TMEM53 prevents SMAD accumulation in the cell nucleus, thus inhibiting BMP signaling in osteoblast lineage cells .

  • Sclerosing Bone Disorder: Deficiency of TMEM53 can lead to a sclerosing bone disorder due to the dysregulation of BMP-SMAD signaling .

TMEM53 Isoforms and Variants

TMEM53 has multiple RefSeq transcripts, such as T.1, T.2, T.3, and T.4, with T.1 showing the highest expression in various tissues and cell types . Genetic variants in TMEM53 have been associated with specific diseases .

Recombinant TMEM53-A Protein

Recombinant Full Length Xenopus Laevis Transmembrane Protein 53-A (Tmem53-A) Protein, His-Tagged is available . It consists of:

  • Species: Xenopus laevis

  • Source: E. coli

  • Tag: His

  • Description: Recombinant Full Length Xenopus laevis Transmembrane protein 53-A(tmem53-a) Protein (Q5PPS7) (1-285aa), fused to N-terminal His tag, was expressed in E. coli .

Related Research on Xenopus laevis Proteins

Other Xenopus laevis proteins, such as p53 and CYP17, have been studied to understand their functions and characteristics .

  • p53: Xenopus laevis p53 (Xp53) can transactivate promoters that are up-regulated by mouse p53, but it cannot cause repression. Its ability to transactivate gene expression is temperature-dependent .

  • CYP17: Xenopus laevis CYP17 regulates androgen production and mediates several reactions in the frog ovary .

NET4/Tmem53 and Cell Cycle Withdrawal

NET4/Tmem53 is involved in stress-dependent cell cycle withdrawal . Overexpression of NET4/Tmem53 can lead to a 2N accumulation effect on the cell cycle profile in HEK293T cells, but this effect is lost when pRb levels are reduced .

Table Summarizing TMEM53 Information

PropertyDescription
Gene NameTMEM53 (Transmembrane protein 53)
Other NamesNET4 (Nuclear Envelope Transmembrane protein 4)
FunctionInhibits BMP-SMAD signaling, regulates bone formation
DeficiencyCauses sclerosing bone disorder by dysregulation of BMP-SMAD signaling
IsoformsT.1, T.2, T.3, T.4
Model OrganismXenopus laevis
ExpressionT.1 shows the highest expression in multiple tissue and cell types
Involvement in Cell CycleInvolved in stress-dependent cell cycle withdrawal

Further Research Avenues

Due to the limited information on Recombinant Xenopus laevis Transmembrane protein 53-B (tmem53-b), further research is needed.

  • Protein Structure and Function: Detailed structural and functional studies of TMEM53-B in Xenopus laevis are necessary to understand its specific roles.

  • Interaction with Other Proteins: Investigating the interaction of TMEM53-B with other proteins can provide insights into its functional mechanisms.

  • Role in Development: Understanding the role of TMEM53-B in Xenopus laevis development can reveal its importance in developmental processes.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tmem53-b; Transmembrane protein 53-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem53-b
Target Protein Sequence
MGDPELDYTIEFPEPSLQGCPWDPEREPVVILLGWGGCKDQYLAKYSAIYHNQGCTVIKY TAAWNAVFISESLGFSSLREDAKKLLELLFDYEIEKSPILFHVFSNGGFMLYRYIVELLH SHCRLNKLHVVGTIFDSAPGNRNVIGSVRALDTILRTSTNNAIRFLALAAFAIMVIILRI VLYPVTKFLHENHYDAMKKDSSRWPQLYLYSRADPIISYIDVESMIAARRRCCLPTEALD FGKSEHVSHFRRFPHRYSEMCTSFLRDCVRKAAVSMLTSEHPVSF
Uniprot No.

Target Background

Database Links

KEGG: xla:446324

UniGene: Xl.23166

Protein Families
TMEM53 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Xenopus laevis Transmembrane protein 53-B (tmem53-b) and what is its UniProt identification?

Transmembrane protein 53-B (tmem53-b) is a nuclear envelope transmembrane protein found in Xenopus laevis (African clawed frog). It is identified in the UniProt database with the accession number Q6DJC8 . The protein consists of 285 amino acids and is believed to play roles in nuclear envelope organization and cellular signaling processes. As a transmembrane protein, it contains hydrophobic regions that anchor it within the nuclear membrane, with domains extending into both the nucleoplasm and cytoplasm.

How does tmem53-b compare functionally to human TMEM53?

While the search results don't provide direct functional comparison between Xenopus laevis tmem53-b and human TMEM53, research on human TMEM53 suggests it plays a critical role in bone formation by inhibiting BMP signaling in osteoblast lineage cells . This inhibition occurs by blocking cytoplasm-nucleus translocation of BMP2-activated Smad proteins.

Loss-of-function pathogenic variants in human TMEM53 have been linked to a previously unknown sclerosing bone disorder (SBD), now termed craniotubular dysplasia, Ikegawa type . Animal models with Tmem53 deficiency recapitulate the human skeletal phenotypes, suggesting evolutionary conservation of function.

Given the structural conservation between species, it's reasonable to hypothesize that Xenopus laevis tmem53-b may have similar functions in regulating BMP signaling pathways, though specific experimental validation in Xenopus systems would be required to confirm this functional homology.

What is known about the three-dimensional structure of tmem53-b?

The three-dimensional structure of Xenopus laevis tmem53-b has been computationally modeled using AlphaFold and is available in the RCSB Protein Data Bank (ID: AF_AFQ6DJC8F1) . This computed structure model has a very high confidence score with a global pLDDT (predicted Local Distance Difference Test) value of 90.98, which indicates strong reliability of the predicted structure .

The structural model suggests that tmem53-b contains both alpha-helical and beta-sheet elements, with transmembrane domains that anchor it to the nuclear envelope. Due to its high confidence score (pLDDT > 90), researchers can use this model with reasonable confidence for structure-based investigations, including:

  • Identification of potential binding sites

  • Planning site-directed mutagenesis experiments

  • Understanding structural changes in disease-associated variants

It's important to note that this is a computed structure rather than an experimentally determined one, so experimental validation of key structural features would still be recommended for critical research applications.

What is the subcellular localization of tmem53-b and how does it affect its function?

Based on homology with other TMEM53 proteins, Xenopus laevis tmem53-b is likely localized to the nuclear envelope. This localization is critical for its function, as it positions the protein at the interface between the nucleus and cytoplasm .

Studies of related proteins suggest that tmem53-b may interact with the nuclear lamina and other nuclear envelope components . For instance, human Nup53, which shares functional similarities with nuclear envelope transmembrane proteins, interacts with lamin B and is tightly associated with the nuclear envelope membrane .

This strategic localization allows tmem53-b to potentially:

  • Regulate nuclear-cytoplasmic transport of signaling molecules

  • Modulate gene expression by affecting chromatin organization near the nuclear periphery

  • Influence nuclear envelope stability and integrity

  • Participate in signal transduction pathways that require nuclear translocation of transcription factors, such as BMP-activated Smad proteins

How does tmem53-b interact with signaling pathways in Xenopus laevis?

While specific interactions of Xenopus laevis tmem53-b with signaling pathways are not directly described in the search results, information about human TMEM53 suggests that tmem53-b may play a role in regulating BMP signaling .

In human cells, TMEM53 has been shown to inhibit BMP signaling by blocking cytoplasm-nucleus translocation of BMP2-activated Smad proteins . Given the conserved nature of both TMEM53 and BMP signaling pathways across vertebrates, it's plausible that Xenopus laevis tmem53-b functions similarly.

This interaction with BMP signaling is particularly significant because:

  • BMP signaling is crucial for embryonic development in Xenopus

  • It influences cell fate decisions and tissue patterning

  • It plays important roles in bone and cartilage formation

Researchers investigating tmem53-b function in Xenopus might focus on its potential interactions with Smad proteins and effects on BMP target gene expression to elucidate its specific role in developmental signaling pathways.

What are the optimal methods for expressing and purifying recombinant Xenopus laevis tmem53-b?

Based on comparable recombinant protein expression methods used for other Xenopus proteins, researchers can employ the following strategy for tmem53-b:

Expression System: The BacMam expression system has proven effective for Xenopus proteins as demonstrated in the crystallization of Xenopus Sizzled . This system involves:

  • Cloning the tmem53-b cDNA into a modified BacMam vector with a C-terminal hexa-histidine tag

  • Co-transfecting Sf9 insect cells with the constructed transfer plasmids and BacVector-3000 baculovirus DNA

  • Harvesting and amplifying the resulting low-titer virus

  • Using the amplified virus to infect HEK293T cells for protein expression

Purification Protocol:

  • Collect the conditioned medium from cell culture

  • Concentrate and buffer-exchange to HEPES-buffered saline (HBS, 10 mM HEPES, pH 7.5, 150 mM NaCl)

  • Capture the protein using Ni²⁺-NTA-agarose affinity chromatography

  • Wash extensively with HBS containing increasing concentrations of imidazole (20 to 300 mM)

  • Subject eluted fractions to gel-filtration chromatography using a Superdex 200 Increase column

  • Pool and concentrate the fractions containing mono-dispersed proteins to 8-10 mg/ml for subsequent experiments

This approach typically yields pure, properly folded protein suitable for structural and functional studies.

What methods are recommended for studying the interaction between tmem53-b and the nuclear lamina?

To investigate the interaction between tmem53-b and nuclear lamina components (such as lamin B), researchers can employ several complementary techniques:

Cell Fractionation:
As demonstrated with human Nup53, cell fractionation can be used to determine the association of tmem53-b with the nuclear envelope membrane and lamina . This involves:

  • Separating cellular components into cytoplasmic, nucleoplasmic, and nuclear envelope fractions

  • Analyzing the distribution of tmem53-b across these fractions by Western blotting

  • Comparing this distribution with known markers of each compartment

In Vitro Binding Assays:

  • Express and purify recombinant tmem53-b and potential lamina binding partners

  • Perform pull-down assays using immobilized proteins

  • Detect interactions through Western blotting or mass spectrometry

  • Quantify binding affinities using techniques like surface plasmon resonance or isothermal titration calorimetry

Co-immunoprecipitation:

  • Prepare nuclear extracts from Xenopus laevis cells or tissues

  • Immunoprecipitate tmem53-b using specific antibodies

  • Analyze co-precipitated proteins by Western blotting or mass spectrometry to identify lamina components

Proximity Labeling:

  • Express tmem53-b fused to a proximity labeling enzyme (BioID or APEX)

  • Allow the enzyme to biotinylate proteins in close proximity to tmem53-b

  • Isolate biotinylated proteins using streptavidin affinity purification

  • Identify interacting partners by mass spectrometry

These approaches provide complementary information about the physical interactions and spatial relationships between tmem53-b and the nuclear lamina.

How can CRISPR/Cas9 gene editing be used to study tmem53-b function in Xenopus laevis?

CRISPR/Cas9 gene editing can be effectively employed to study tmem53-b function in Xenopus laevis, following protocols similar to those used for generating Tmem53 mutant mice :

Guide RNA Design and Preparation:

  • Design guide RNAs (gRNAs) targeting the tmem53-b gene using tools like GPP sgRNA Designer and CRISPR direct

  • PCR-amplify a DNA fragment containing T7 promoter followed by the gRNA sequence

  • Clone this fragment into a suitable vector (e.g., pUC19)

  • Generate gRNAs by T7 in vitro transcription using a kit like MEGAshortscript Kit

  • Prepare Cas9 mRNA by subcloning the Cas9 coding sequence into a vector with T7 promoter and synthesizing using mMESSAGE mMACHINE T7 Ultra Kit

Microinjection and Embryo Handling:

  • Dissolve Cas9 mRNA (20 ng/μl) and gRNAs (5 ng/μl) in 10 mM Tris-HCl solution containing 0.1 mM EDTA (pH 8.0)

  • Microinject the mixture into the cytoplasm of fertilized Xenopus eggs

  • Transfer the eggs to surrogate female Xenopus for development

  • Identify mutations in the offspring by Sanger sequencing of genomic DNA from tail tip biopsies

Phenotypic Analysis:

  • Establish lines from founder frogs carrying frameshift mutations

  • Analyze phenotypes at different developmental stages

  • Perform molecular analyses (RNA-seq, ChIP-seq, etc.) to identify affected pathways

  • Conduct rescue experiments by reintroducing wild-type tmem53-b to confirm specificity

This approach allows for the generation of tmem53-b knockout or knockin Xenopus laevis models to study its function in vivo.

How conserved is tmem53-b across species and what does this suggest about its function?

Although the search results don't provide direct cross-species comparison of tmem53-b, the functional conservation of related proteins like TMEM53 between humans and mice suggests evolutionary conservation of this protein family . This conservation likely extends to Xenopus laevis tmem53-b.

Bi-allelic loss-of-function pathogenic variants in human TMEM53 cause a sclerosing bone disorder, and Tmem53-/- mice recapitulate these skeletal phenotypes . This functional conservation across mammals suggests that:

  • The protein plays a fundamental role in vertebrate development and physiology

  • Key structural domains and motifs are likely preserved across species

  • Core signaling pathways regulated by tmem53-b (such as BMP signaling) are probably conserved

To analyze this conservation more thoroughly, researchers could:

  • Perform multiple sequence alignments of tmem53-b from different species

  • Identify conserved domains, motifs, and residues

  • Map these conserved elements onto the structural model

  • Correlate conservation patterns with known functional regions

High conservation of specific regions would suggest functional importance and could guide experimental design for functional studies.

How does tmem53-b in Xenopus laevis compare to its homologs in mammals?

While the search results don't provide a direct comparison between Xenopus laevis tmem53-b and mammalian homologs, we can draw some insights based on related studies.

The human TMEM53 protein has been shown to inhibit BMP signaling by blocking cytoplasm-nucleus translocation of BMP2-activated Smad proteins . Given the conserved nature of BMP signaling across vertebrates, Xenopus laevis tmem53-b may share this function.

Like human Nup53 (a related nuclear envelope protein), Xenopus laevis tmem53-b is likely associated with the nuclear envelope membrane and interacts with nuclear lamina components . This localization would position it to regulate nuclear-cytoplasmic transport and signaling.

Key differences may exist in:

  • Tissue-specific expression patterns

  • Developmental timing of expression

  • Specific binding partners

  • Regulatory mechanisms

Comparative studies examining these aspects could provide insights into both conserved functions and species-specific adaptations of tmem53-b across vertebrates.

How can site-directed mutagenesis of tmem53-b inform our understanding of its structure-function relationships?

Site-directed mutagenesis of Xenopus laevis tmem53-b can be a powerful approach to elucidate structure-function relationships by systematically altering key residues and analyzing the effects on protein function. Based on approaches used with other proteins, researchers could:

Target Selection Strategy:

  • Identify conserved residues across species that may be functionally important

  • Focus on residues in predicted functional domains based on the AlphaFold structure

  • Select residues matching positions of human disease-causing mutations in TMEM53

  • Target residues at predicted interaction interfaces with binding partners

Experimental Design:

  • Create a panel of single-point mutants and/or deletion constructs

  • Express wild-type and mutant proteins in cell culture systems

  • Analyze effects on:

    • Protein localization (using fluorescent tags)

    • Binding to known interaction partners (using co-IP or pull-down assays)

    • Impact on signaling pathways (using reporter assays for BMP signaling)

    • Nuclear envelope structure and integrity (using microscopy techniques)

The results from such studies would provide insights into which regions of tmem53-b are critical for its various functions and how specific residues contribute to protein-protein interactions, membrane association, and signaling regulation.

What approaches are recommended for studying tmem53-b's role in BMP signaling in Xenopus embryos?

To investigate tmem53-b's potential role in BMP signaling in Xenopus embryos, researchers can employ several complementary approaches:

Loss-of-Function Studies:

  • Use CRISPR/Cas9 to generate tmem53-b knockout embryos as described earlier

  • Alternatively, employ morpholino oligonucleotides or dominant-negative constructs for acute knockdown

  • Analyze effects on BMP-dependent developmental processes such as dorsal-ventral patterning and mesoderm induction

  • Perform rescue experiments with wild-type or mutant tmem53-b to confirm specificity

Gain-of-Function Studies:

  • Overexpress wild-type or constitutively active forms of tmem53-b in specific tissues

  • Assess effects on BMP target gene expression and developmental outcomes

  • Determine whether tmem53-b overexpression can rescue phenotypes caused by altered BMP signaling

Molecular Analyses:

  • Monitor Smad phosphorylation and nuclear localization in control vs. tmem53-b-depleted embryos

  • Perform ChIP-seq for phospho-Smad1/5/8 to identify affected target genes

  • Use RNA-seq to analyze global transcriptional changes following tmem53-b manipulation

  • Employ proximity labeling (BioID) to identify proteins interacting with tmem53-b in vivo

Biochemical Interaction Studies:

  • Express recombinant tmem53-b and components of the BMP signaling pathway

  • Perform co-immunoprecipitation or pull-down assays to detect direct interactions

  • Use fluorescence microscopy to visualize co-localization of tmem53-b with BMP signaling components

These approaches would provide complementary insights into how tmem53-b influences BMP signaling during Xenopus development.

How might studying tmem53-b in Xenopus laevis contribute to understanding human diseases related to TMEM53 mutations?

Studying tmem53-b in Xenopus laevis can significantly contribute to understanding human diseases related to TMEM53 mutations, particularly the recently identified sclerosing bone disorder (craniotubular dysplasia, Ikegawa type) . This approach offers several advantages:

Modeling Disease Mutations:

  • Create Xenopus models carrying equivalent mutations to those found in human patients

  • Use CRISPR/Cas9 to introduce precise mutations or humanized versions of TMEM53

  • Analyze resulting phenotypes throughout development

  • Test potential therapeutic interventions in a whole-organism context

Developmental Context:

  • Xenopus embryos develop externally and rapidly, allowing easy visualization of developmental processes

  • Transparent embryos facilitate live imaging of cellular behaviors

  • The developmental timeline is well-characterized, enabling precise temporal studies

  • Tissue-specific manipulations can be achieved through targeted microinjection

Mechanism Elucidation:

  • Analyze BMP signaling in tmem53-b mutant embryos to confirm the proposed mechanism

  • Investigate additional signaling pathways potentially affected by tmem53-b dysfunction

  • Perform transcriptomic and proteomic analyses to identify global changes

  • Use chemical genetic approaches to identify compounds that modify tmem53-b-related phenotypes

Translational Applications:

  • Screen small molecules for their ability to rescue tmem53-b mutant phenotypes

  • Test gene therapy approaches using Xenopus as a model system

  • Identify potential biomarkers for early diagnosis of TMEM53-related disorders

  • Develop tissue-specific interventions based on developmental insights

This research could ultimately lead to improved diagnosis, prognosis, and treatment strategies for human patients with TMEM53 mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.