Recombinant Xenopus laevis Transmembrane protein 55B (tmem55b)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Transmembrane Protein 55B (TMEM55B)

Recombinant Xenopus laevis Transmembrane protein 55B (TMEM55B) is a protein that has garnered attention for its role in cellular processes, particularly those related to cholesterol metabolism and lysosomal function . TMEM55B is a transmembrane protein, meaning it spans the cell membrane, allowing it to interact with both the inside and outside of the cell . The "Xenopus laevis" designation indicates that this protein originates from the African clawed frog, a commonly used model organism in biological research . Recombinant production implies the protein is produced using genetic engineering techniques, often in a system like Xenopus laevis oocytes, to facilitate研究 and analysis .

Role in Cholesterol Metabolism

TMEM55B has been identified as a novel regulator of cellular cholesterol metabolism . Specifically, it influences the levels of plasma cholesterol by affecting the degradation of the LDL receptor (LDLR) in lysosomes, which is mediated by phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2) .

  • Regulation of LDLR Activity: TMEM55B modulates LDLR activity through PI(4,5)P2. Knockdown of TMEM55B leads to increased levels of PI(4,5)P2, affecting LDLR's lysosomal degradation .

  • Impact on Lipoproteins: Studies involving the knockdown of Tmem55b in mice have shown increased plasma cholesterol levels in the LDL size range. Additionally, there was an increase in apolipoprotein E (ApoE) levels across various fractions . Ion mobility analyses confirmed that Tmem55b knockdown significantly increased lipoprotein levels, particularly in the small LDL size range .

Lysosomal Function and ER Interactions

TMEM55B is localized in endosomes and lysosomes, where it functions in regulating PI(4,5)P2 levels . It interacts with other proteins, such as Tex2, at ER-LE/lysosome membrane contact sites (MCSs), which are essential for lysosomal functions .

  • Interaction with Tex2: TMEM55B recruits Tex2 to ER-LE/Lys MCSs, which are required for lysosomal function . Overexpression of TMEM55B can recruit Tex2 to perinuclear regions, indicating a regulatory role in the localization of Tex2 .

Experimental Techniques and Applications

The study of TMEM55B involves various experimental techniques to understand its function and interactions.

  • Expression in Xenopus laevis Oocytes: Xenopus laevis oocytes are utilized for the expression and purification of recombinant proteins, including TMEM55B. This system allows for the production of milligram amounts of purified proteins, which can then be used for structural and functional studies .

  • Fast Protein Liquid Chromatography (FPLC): FPLC is used to analyze plasma lipoprotein levels following genetic manipulation of Tmem55b in animal models. This technique helps in determining the distribution and levels of cholesterol and apolipoproteins in different lipoprotein fractions .

  • Confocal Microscopy and Flow Cytometry: These techniques are employed to confirm the effects of TMEM55B knockdown or overexpression on cellular PI(4,5)P2 levels and localization . Confocal microscopy is also used to visualize the interaction between TMEM55B and other proteins like Tex2 .

Data Tables

ExperimentObservation
Tmem55b Knockdown in MiceIncreased plasma cholesterol in LDL size range; increased ApoE levels
TMEM55B Knockdown in HepG2 CellsIncreased cellular PI(4,5)P2 levels; increased PI(4,5)P2-LAMP1 colocalization
TMEM55B Overexpression in HepG2 CellsDecreased cellular PI(4,5)P2 levels
Co-immunoprecipitation with GFP-Tex2Identification of TMEM55B as a Tex2-interacting protein
Overexpression of Halo-TMEM55B with GFP-Tex2Recruitment of GFP-Tex2 to perinuclear regions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
pip4p1; tmem55b; Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase; Type 1 PtdIns-4,5-P2 4-Ptase; PtdIns-4,5-P2 4-Ptase I; Transmembrane protein 55B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MADGERSPLLSDLGDGGGMGAAMGPGAPSPGSALPTAPPYGGPGPASNKPQGFPEFPAAH GSVITGEDPPPYSPLTSPESGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPIKNA PQGKKYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHAGPLSPEPQPVGVRVICGH CKNNFLWTEFSDRTLARCPHCRKVSSIGMRYPRKRCFCCFLLGVLLALAAAGLVGGTWTL AYKYGGIYASWAILLLLALACIGRGIYWACMRVSHPVQSFS
Uniprot No.

Target Background

Function

This protein catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P).

Database Links

KEGG: xla:494834

UniGene: Xl.52972

Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Q&A

What is TMEM55B and what are its primary cellular functions?

TMEM55B (Transmembrane protein 55B) is a lysosomal transmembrane protein that functions as a novel regulator of cellular cholesterol metabolism. It modulates Low-Density Lipoprotein Receptor (LDLR) levels and activity through post-transcriptional mechanisms . TMEM55B localizes to the endosome/lysosome compartment and plays critical roles in restoring cellular homeostasis in response to oxidative stress .

Recent research has identified three key mechanisms through which TMEM55B contributes to cellular homeostasis:

  • Mediating NEDD4-dependent PLEKHM1 ubiquitination, causing PLEKHM1 proteasomal degradation and halting autophagosome/lysosome fusion

  • Promoting recruitment of ESCRT machinery components to lysosomal membranes to stimulate lysosomal repair

  • Sequestering the FLCN/FNIP complex to facilitate translocation of transcription factor TFE3 to the nucleus, allowing expression of transcriptional programs that enable cellular adaptation to stress

Additionally, TMEM55B functions as a regulator of lysosomal positioning by binding to the dynein adapter JIP4, promoting dynein-dynactin-dependent lysosomal trafficking to the perinuclear region .

Why is Xenopus laevis a suitable model for studying TMEM55B?

Xenopus laevis offers several key advantages as an experimental model for studying proteins like TMEM55B:

  • External developmental environment free of maternal influence, allowing easy experimental access from early developmental stages

  • An immune system remarkably similar to mammals, making findings potentially translatable

  • Availability of large-scale genetic and genomic resources

  • Amenability to experimental manipulation (e.g., thymectomy, blocking, or accelerating metamorphosis)

  • Transparency of tadpole stage, ideal for intravital microscopy studies in real time

  • Implementation of genome-editing technology, particularly in X. tropicalis, enabling characterization of gene function

These features make Xenopus laevis particularly valuable for studies involving cellular homeostasis, stress responses, and lysosomal function - all processes in which TMEM55B plays important roles.

What expression systems are optimal for producing recombinant Xenopus laevis TMEM55B protein?

E. coli expression systems have been successfully used to produce recombinant full-length Xenopus laevis TMEM55B protein . For optimal expression:

  • Use a construct containing the full-length TMEM55B sequence (amino acids 1-281) with an N-terminal His tag for purification

  • Express in an appropriate E. coli strain optimized for mammalian protein expression

  • After expression, purify the protein using nickel affinity chromatography, leveraging the His tag

  • Following purification, dialyze against a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose

  • For storage, lyophilize the purified protein or store in aliquots at -20°C/-80°C

  • When reconstituting, use deionized sterile water to a concentration of 0.1-1.0 mg/mL and add 5-50% glycerol (final concentration) for long-term storage stability

This approach typically yields protein with >90% purity as determined by SDS-PAGE analysis .

How can researchers effectively perform TMEM55B knockdown studies?

Based on methodologies used in previous TMEM55B studies, researchers should:

  • Design two or more siRNAs targeting different regions of TMEM55B mRNA to ensure specificity and reproducibility of results

  • Transfect human hepatoma cell lines (such as HepG2 or Huh7) with TMEM55B-siRNAs and appropriate non-targeting control siRNAs

  • Verify knockdown efficiency by measuring TMEM55B mRNA levels via qPCR and protein levels via western blotting at 48-72 hours post-transfection

  • When studying effects on protein degradation, treat cells with cycloheximide (an inhibitor of protein synthesis) after siRNA transfection

  • Collect samples at various time points (0-3 hours) post-cycloheximide treatment to assess protein decay rates

  • Analyze effects on related pathways by measuring transcript levels of other genes (e.g., LDLR, HMGCR, PCSK9)

This approach has successfully demonstrated that TMEM55B knockdown accelerates LDLR protein decay rate without reducing LDLR transcript levels, suggesting post-transcriptional regulation .

How does TMEM55B affect cholesterol metabolism in cells?

TMEM55B regulates cellular cholesterol metabolism primarily through modulation of LDLR (Low-Density Lipoprotein Receptor) activity and turnover. Mechanistically:

  • TMEM55B affects LDLR protein stability and cell surface levels through post-transcriptional mechanisms

  • When TMEM55B is knocked down, LDLR protein exhibits accelerated decay rates, despite a 20-50% increase in LDLR transcript levels

  • This suggests TMEM55B normally acts to stabilize LDLR protein or maintain its proper cellular localization

  • Importantly, TMEM55B knockdown does not consistently change transcript levels of other SREBF2 target genes like HMGCR or PCSK9

  • Since TMEM55B localizes to the endosome/lysosome compartment where LDLR recycles between this compartment and the cell surface, TMEM55B likely modulates LDLR turnover, activity, or localization in this pathway

These findings establish TMEM55B as a key post-transcriptional regulator of LDLR metabolism, thereby influencing cellular cholesterol homeostasis.

What is the relationship between TMEM55B and cellular response to oxidative stress?

TMEM55B functions as a molecular sensor coordinating multiple cellular processes in response to oxidative stress:

  • Autophagosome degradation: TMEM55B mediates NEDD4-dependent PLEKHM1 ubiquitination, leading to PLEKHM1 proteasomal degradation. This halts autophagosome/lysosome fusion, a critical control point in the autophagy process.

  • Lysosomal repair: TMEM55B promotes recruitment of ESCRT (Endosomal Sorting Complexes Required for Transport) machinery components to damaged lysosomal membranes, stimulating repair processes that maintain lysosomal integrity during stress.

  • Transcriptional adaptation: TMEM55B sequesters the FLCN/FNIP complex, facilitating translocation of transcription factor TFE3 to the nucleus. This enables expression of stress response genes that help cells adapt to oxidative conditions.

The biological significance of these mechanisms is demonstrated by experiments in zebrafish embryos, where knockout of tmem55 genes significantly increases susceptibility to oxidative stress, causing early death of tmem55-KO animals when exposed to arsenite toxicity .

How can TMEM55B be used to study lysosomal positioning and dynamics?

To leverage TMEM55B for studying lysosomal dynamics, researchers should:

  • Generate fluorescently tagged TMEM55B constructs (e.g., TMEM55B-GFP) for live-cell imaging

  • Establish stable cell lines with inducible TMEM55B expression or depletion

  • Use confocal microscopy with lysosomal markers to track changes in lysosomal distribution

  • Employ pull-down assays to study TMEM55B interaction with the dynein adapter JIP4

  • Perform co-immunoprecipitation experiments to identify additional binding partners

  • Utilize super-resolution microscopy techniques to visualize TMEM55B-mediated lysosomal trafficking at high resolution

  • Develop computational approaches to quantify changes in lysosomal positioning (perinuclear vs. peripheral distribution)

The documented role of TMEM55B in binding to JIP4 and promoting dynein-dynactin-dependent lysosomal trafficking to the perinuclear region makes it an excellent probe for studying mechanisms of organelle positioning .

What are the methodological considerations for studying TMEM55B's role in autophagy and lysosomal repair?

To effectively investigate TMEM55B's functions in autophagy and lysosomal repair:

  • Autophagosome-lysosome fusion analysis:

    • Monitor LC3-II and p62 levels by western blotting to assess autophagy flux

    • Use tandem fluorescent LC3 (mRFP-GFP-LC3) to distinguish autophagosomes from autolysosomes

    • Examine PLEKHM1 ubiquitination status using ubiquitin antibodies and immunoprecipitation

    • Apply proteasome inhibitors to confirm PLEKHM1 degradation pathway

  • Lysosomal repair mechanisms:

    • Induce lysosomal damage using specific agents (e.g., LLOMe)

    • Visualize ESCRT machinery recruitment using immunofluorescence

    • Assess lysosomal membrane integrity with galectin-3 puncta assays

    • Measure lysosomal pH using LysoSensor dyes

    • Monitor calcium flux from damaged lysosomes

  • Transcriptional response evaluation:

    • Track TFE3 nuclear translocation using subcellular fractionation and immunofluorescence

    • Analyze interaction between TMEM55B and FLCN/FNIP complex using proximity ligation assays

    • Perform ChIP-seq to identify TFE3 target genes activated during stress response

    • Use RNA-seq to quantify global transcriptional changes dependent on TMEM55B

These approaches will provide comprehensive insights into TMEM55B's multifaceted roles in cellular stress responses.

How do researchers effectively utilize Xenopus laevis for in vivo studies of TMEM55B function?

To leverage the Xenopus laevis model for TMEM55B research:

  • Early development manipulation:

    • Microinject TMEM55B morpholinos or mRNA into fertilized eggs

    • Create tissue-specific knockdown using targeted electroporation

    • Establish transgenic lines using I-SceI meganuclease-mediated transgenesis

  • Tadpole-stage experiments:

    • Exploit tadpole transparency for intravital microscopy studies

    • Track lysosomes and autophagy dynamics in live animals

    • Challenge with oxidative stressors to assess TMEM55B's protective functions

  • Comparative studies:

    • Compare TMEM55B functions between tadpole and adult stages

    • Examine differences between X. laevis and X. tropicalis TMEM55B responses

    • Investigate tissue-specific functions of TMEM55B during metamorphosis

  • Genome editing approaches:

    • Apply CRISPR/Cas9 technology to generate TMEM55B knockout or knockin models

    • Create point mutations to disrupt specific protein interactions

    • Develop inducible expression systems to control TMEM55B activity temporally

Xenopus offers unique advantages for these studies due to its external development, susceptibility to micromanipulation, and established genetic tools.

What are the similarities and differences in TMEM55B function between amphibian and mammalian systems?

Research comparing TMEM55B across species reveals important evolutionary conservation and divergence:

Conserved features:

  • Subcellular localization: TMEM55B localizes to lysosomes in both amphibian and mammalian cells

  • Response to cellular stress: In both systems, TMEM55B plays protective roles against oxidative damage

  • Structural domains: The functional domains and catalytic residues show high conservation

  • Involvement in lysosomal positioning: TMEM55B regulates lysosomal distribution in both systems

  • Role in autophagy regulation: TMEM55B affects autophagosome-lysosome fusion across species

Species-specific differences:

  • Expression patterns: Tissue-specific expression levels and developmental timing may vary

  • Interaction partners: While core interactions are conserved, peripheral protein interactions may differ

  • Regulatory mechanisms: Transcriptional and post-translational regulation might show species-specific features

  • Sensitivity to stressors: Xenopus TMEM55B may respond differently to specific environmental conditions compared to mammalian orthologs

  • Functional redundancy: The degree of compensation by related proteins might vary between species

Understanding these similarities and differences is crucial for translating findings between model systems and for determining the evolutionary conservation of TMEM55B functions.

What are common technical issues when working with recombinant TMEM55B protein and how can they be addressed?

Researchers working with recombinant Xenopus laevis TMEM55B protein often encounter these challenges:

Challenge 1: Protein solubility and aggregation

  • Solution: Add 6% trehalose to storage buffer to enhance stability

  • Avoid repeated freeze-thaw cycles by creating single-use aliquots

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage stability

Challenge 2: Decreased activity after storage

  • Solution: Store at -20°C/-80°C upon receipt

  • Working aliquots can be stored at 4°C for up to one week

  • Centrifuge vials briefly before opening to bring contents to the bottom

  • Use Tris/PBS-based buffer at pH 8.0 for optimal stability

Challenge 3: Transmembrane domain interference with functional assays

  • Solution: Consider using truncated constructs that exclude the transmembrane domain for specific applications

  • Alternatively, employ detergent solubilization protocols optimized for membrane proteins

  • Use lipid nanodisc systems to maintain native membrane environment

Challenge 4: Verification of protein activity

  • Solution: Develop specific activity assays based on TMEM55B's known functions

  • Confirm proper folding using circular dichroism or limited proteolysis

  • Validate binding to known interaction partners through pull-down assays

Addressing these challenges is essential for obtaining reliable results in biochemical and functional studies of TMEM55B.

How can researchers effectively analyze and interpret data from TMEM55B knockout or knockdown experiments?

When analyzing data from TMEM55B genetic manipulation studies:

  • Controls and validation:

    • Include multiple independent siRNAs or knockout approaches to control for off-target effects

    • Validate knockdown/knockout efficiency at both mRNA and protein levels

    • Include rescue experiments with wild-type TMEM55B to confirm specificity of observed phenotypes

  • Multifaceted phenotypic analysis:

    • Examine effects on all three TMEM55B-regulated processes: autophagy, lysosomal repair, and transcriptional responses

    • Conduct time-course experiments to distinguish primary from secondary effects

    • Challenge cells with various stressors to fully assess the stress-protective functions of TMEM55B

  • Context-dependent interpretation:

    • Consider cell type-specific effects, as TMEM55B function may vary between tissues

    • Account for compensatory mechanisms that may mask phenotypes in long-term knockout models

    • Analyze acute vs. chronic depletion effects separately

  • Quantitative approaches:

    • Employ rigorous statistical analysis appropriate for the experimental design

    • Utilize unbiased quantification methods for imaging data

    • Consider systems biology approaches to understand network effects of TMEM55B perturbation

The knockout of tmem55 genes in zebrafish provides an excellent example - researchers observed increased susceptibility to oxidative stress, but this phenotype was only evident upon arsenite challenge, highlighting the importance of appropriate stress conditions for phenotypic assessment .

What are promising unexplored research areas regarding TMEM55B function in Xenopus laevis?

Several promising research directions remain unexplored:

  • Developmental roles:

    • Investigate TMEM55B expression patterns during Xenopus embryonic development

    • Examine the relationship between TMEM55B function and metamorphosis-associated tissue remodeling

    • Study potential roles in developmental autophagy and cell fate decisions

  • Immune system regulation:

    • Explore TMEM55B's role in Xenopus immune responses, leveraging the model's advantages for immunological research

    • Investigate how TMEM55B-mediated lysosomal functions contribute to pathogen defense

    • Examine connections between TMEM55B and amphibian-specific immune mechanisms

  • Regenerative capacity:

    • Study TMEM55B involvement in the remarkable regenerative abilities of Xenopus tadpoles

    • Analyze how TMEM55B-regulated autophagy and lysosomal functions contribute to tissue regeneration

    • Compare TMEM55B activity in regeneration-competent versus regeneration-incompetent developmental stages

  • Environmental adaptations:

    • Investigate how TMEM55B functions respond to environmental stressors relevant to amphibian habitats

    • Examine potential roles in adapting to temperature fluctuations, toxin exposure, and pathogen challenges

    • Study how TMEM55B contributes to stress resilience during metamorphosis

These research directions would leverage the unique advantages of the Xenopus model system while expanding our understanding of TMEM55B biology.

What are emerging technologies that could advance TMEM55B research?

Cutting-edge technologies offering new opportunities for TMEM55B research include:

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize TMEM55B at lysosomal membranes with nanometer precision

    • Intravital microscopy in transparent Xenopus tadpoles to track TMEM55B-mediated processes in vivo

    • Correlative light and electron microscopy to connect TMEM55B localization with ultrastructural features

  • Genome editing and screening:

    • CRISPR/Cas9-mediated precise editing to create point mutations in functional domains

    • CRISPR interference/activation approaches for tissue-specific and tunable expression modulation

    • Genome-wide CRISPR screens to identify genetic interactors of TMEM55B

  • Single-cell technologies:

    • Single-cell RNA-seq to map TMEM55B expression across cell types and developmental stages

    • Single-cell proteomics to analyze TMEM55B protein levels and modifications

    • Spatial transcriptomics to determine tissue-specific TMEM55B expression patterns

  • Structural biology advancements:

    • Cryo-electron microscopy to determine TMEM55B structure in membrane environments

    • Hydrogen-deuterium exchange mass spectrometry to map protein interaction interfaces

    • In silico modeling and molecular dynamics simulations to predict functional mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.