Recombinant Xenopus laevis Transmembrane protein 85 (tmem85)

Shipped with Ice Packs
In Stock

Description

General Information

TMEM85, or Transmembrane protein 85, is a protein found in both humans and yeast, and it has been identified in Xenopus laevis . The TMEM88 gene, which relates to TMEM85, consists of 1214 bases and is located at position p13.1 on chromosome 17 . The TMEM88 protein has 159 amino acid residues and a molecular weight of 17251 Da . TMEM85's function is still largely unknown, but research is ongoing .

Role in Xenopus laevis Research

Xenopus laevis, also known as the African clawed frog, serves as a significant model organism in biological research due to its close evolutionary relationship to higher vertebrates, which allows researchers to study various biological processes, including gene expression, organ development, and immune responses . Xenopus laevis is used as an infection model for studying ranavirus-host immune interactions .

TMEM85 and the Immune Response in Xenopus laevis

Xenopus laevis has been used to study the antiviral interferon (IFN) responses . Researchers have identified and characterized an X. laevis type I interferon in the context of infection with the ranavirus frog virus 3 (FV3) . Studies have shown that FV3-infected adult frogs displayed more robust IFN gene expression than tadpoles, which may explain why adult frogs typically clear FV3 infections, whereas tadpoles often succumb to them .

TMEM85 and Cancer Research

Research has also demonstrated that TMEM88 expression levels vary in different types of breast cancer, with cytoplasmic and nuclear TMEM88 showing tissue distribution specificity . This suggests that TMEM88 could be a therapeutic target for breast cancer treatment, though further research is needed to clarify the specific mechanisms and intervention potential .

TMEM85 and Embryonic Development

Studies have found that when TMEM88 expression is significantly upregulated in human embryonic kidney cells, the Wnt/β-catenin signal transduction process is inhibited, while silencing TMEM88 can activate this signaling pathway . TMEM88 can inhibit Wnt/β-catenin signal activation in human embryonic stem cells, thereby regulating their differentiation and development into cardiomyocytes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
emc4; tmem85; ER membrane protein complex subunit 4; Transmembrane protein 85
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
emc4
Target Protein Sequence
MATPTNLVTNRGRRFKWAIEFGSGGSRGRGERGGLQDSMYPVGYSDKQVPDTSVQESDHI LVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPIMMVCMMAWRPIQALLATPATFKLL ESSGQRFLQGLVYLIGNLLGLALGVYKCQSMGLLPTHASDWLAFIEPPERMEYTGGGFLL
Uniprot No.

Target Background

Function

Xenopus laevis transmembrane protein 85 (TMEM85) is a component of the endoplasmic reticulum membrane protein complex (EMC). It facilitates the energy-independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum. TMEM85 preferentially accommodates proteins with weakly hydrophobic transmembrane domains or those containing destabilizing features, such as charged and aromatic residues. It plays a crucial role in the co-translational insertion of multi-pass membrane proteins, where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. Furthermore, it is essential for the post-translational insertion of tail-anchored (TA) proteins into endoplasmic reticulum membranes. By mediating the precise co-translational insertion of N-terminal transmembrane domains in an N-exo topology (with a translocated N-terminus in the ER lumen), TMEM85 controls the topology of multi-pass membrane proteins, including G protein-coupled receptors. Its regulation of protein membrane insertion indirectly influences numerous cellular processes.

Database Links

KEGG: xla:100101270

UniGene: Xl.21650

Protein Families
EMC4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What makes Xenopus laevis a suitable model for studying transmembrane proteins like tmem85?

Xenopus laevis (African clawed frog) serves as an excellent model system for transmembrane protein research due to its unique experimental advantages. As a pseudotetraploid vertebrate living in fresh water, it offers high conservation of essential cellular and molecular mechanisms across species. The system is relatively inexpensive, easily manipulated, and provides large amounts of material for diverse experimental procedures . The oocytes are exceptionally large (>1mm diameter) with synchronous cell cycles, making them ideal for expression and functional studies of membrane proteins. Additionally, the breeding can be controlled through hormone injections to obtain eggs 3-4 times yearly, ensuring consistent experimental material availability .

How does the tetraploid nature of Xenopus laevis affect tmem85 research compared to using Xenopus tropicalis?

The allopolyploid nature of Xenopus laevis (tetraploid with N=18 chromosomes) presents both challenges and opportunities for tmem85 research. Unlike the diploid Xenopus tropicalis (N=10), X. laevis likely contains duplicate copies (alloalleles) of many genes, including transmembrane proteins like tmem85 . This redundancy often necessitates targeting both gene copies in loss-of-function studies. The divergence between alloalleles dates to approximately 40 million years ago, and while functional redundancy is retained in many cases, others show evidence of sub- or neo-functionalization . Researchers must consider this genomic complexity when designing experiments, particularly for genetic manipulation. For genetic studies requiring simpler interpretation, X. tropicalis offers advantages with its canonical diploid genome organization, while X. laevis remains valuable for biochemical and expression analyses of transmembrane proteins .

What expression patterns have been characterized for tmem85 during Xenopus laevis development?

Transmembrane proteins in Xenopus show dynamic expression patterns throughout embryogenesis, from oocyte to tadpole stages. The developmental time course of Xenopus oocytes involves a nuclear envelope with large pores that facilitate transportation between cytoplasm and nucleus, making it an excellent system for studying membrane protein trafficking and localization . When investigating tmem85 expression, researchers typically utilize stage-specific analyses to correlate expression with developmental events. Methodologically, this involves collecting embryos at defined Nieuwkoop and Faber stages, extracting RNA or protein, and performing quantitative analyses through RT-qPCR or Western blotting. In situ hybridization provides spatial information about expression patterns in different tissues. Combining these approaches reveals how transmembrane protein expression relates to organ formation and tissue specification during development.

What are the most effective systems for recombinant expression of Xenopus laevis tmem85?

For recombinant expression of transmembrane proteins from Xenopus laevis, several systems offer distinct advantages depending on the experimental goals. The most widely used approach leverages the Xenopus oocyte itself as an expression system through microinjection of synthesized mRNA. This autologous system ensures proper post-translational modifications and membrane insertion. For larger-scale production, heterologous systems including baculovirus-infected insect cells (Sf9, High Five) provide a eukaryotic environment conducive to proper folding of complex transmembrane proteins while offering higher yields.

When functional analysis is the priority, the following protocol has proven effective for transmembrane protein expression in Xenopus oocytes:

  • Clone the tmem85 coding sequence into an expression vector containing appropriate 5' and 3' UTRs

  • Linearize the plasmid and synthesize capped mRNA using SP6 or T7 RNA polymerase

  • Inject 5-25 ng of mRNA into stage V-VI oocytes

  • Incubate at 18°C for 48-72 hours in OR2 medium

  • Verify expression via Western blotting with specific antibodies or functional assays

This approach yields functional transmembrane proteins integrated into the oocyte membrane, suitable for electrophysiological or trafficking studies.

How can researchers optimize transgenic expression of tmem85 in Xenopus embryos?

Optimizing transgenic expression of transmembrane proteins like tmem85 in Xenopus embryos can be achieved through restriction enzyme-mediated insertion (REMI), a powerful technique for large-scale transgenesis . The methodology involves:

  • Mixing transgene DNA containing the tmem85 coding sequence with purified and permeabilized sperm

  • Adding a small amount of restriction enzyme and high-speed interphase egg extract

  • Injecting this mixture into unfertilized dejellied eggs

  • Screening resultant embryos for expression

What purification strategies yield functional recombinant tmem85 protein with minimal aggregation?

Purifying functional transmembrane proteins while maintaining their native structure presents significant challenges due to their hydrophobic nature. For tmem85 and similar transmembrane proteins from Xenopus, a systematic approach involves:

  • Solubilization optimization:

    • Screen 8-12 different detergents (ranging from harsh ionic detergents to milder non-ionic options)

    • Test detergent concentrations from 0.5-3% for extraction efficiency

    • Validate protein stability in each detergent condition over 24-72 hours

  • Chromatography strategy:

    • Initial capture via affinity chromatography (typically His-tag or FLAG-tag)

    • Intermediate purification using ion exchange chromatography

    • Final polishing step via size exclusion chromatography

  • Stabilization methods:

    • Maintain critical lipids identified from the native membrane environment

    • Add cholesterol hemisuccinate (CHS) at 0.1-0.2% to stabilize transmembrane domains

    • Consider amphipols or nanodiscs for final stabilization

The purification buffer typically contains 20mM HEPES pH 7.4, 150mM NaCl, 10% glycerol, and the optimal detergent at 2-3× critical micelle concentration, supplemented with protease inhibitors. This approach maximizes the recovery of properly folded, functional protein while minimizing aggregation.

How can conditional gene expression systems be used to study tmem85 function in specific tissues?

Conditional gene expression systems provide precise spatiotemporal control over tmem85 expression, enabling tissue-specific functional studies. The transgenic Xenopus laevis strain A7, which expresses Cre recombinase under the control of the muscle-specific cardiac actin promoter, demonstrates the application of such systems . When crossed with appropriate reporter strains, A7 can induce expression of EYFP, DsRed2, or LacZ reporter genes specifically in muscle cells . To adapt this methodology for studying tmem85:

  • Generate a transgenic "responder" strain containing tmem85 behind a loxP-flanked stop cassette

  • Cross this strain with the tissue-specific Cre "driver" strain (e.g., A7 for muscle expression)

  • In the resulting offspring, tmem85 will be expressed only in tissues expressing Cre recombinase

  • Analyze phenotypic effects through morphological assessment, protein localization, and functional assays

This approach allows researchers to bypass embryonic lethality that might result from global tmem85 manipulation and isolate function to specific tissues of interest. The method is particularly valuable for transmembrane proteins that may have distinct functions in different cell types .

What imaging techniques best visualize tmem85 localization in Xenopus tissues?

For optimal visualization of transmembrane protein localization in Xenopus tissues, a multi-modal imaging approach yields the most comprehensive results. High-resolution confocal microscopy remains the workhorse technique, particularly when combined with:

  • Fluorescent protein fusions:

    • Generate C- or N-terminal GFP/mCherry fusions with tmem85 while preserving transmembrane topology

    • Express via mRNA injection or stable transgenesis using REMI technology

    • For dynamic studies, photoconvertible proteins like Dendra2 allow pulse-chase analysis of protein movement

  • Immunofluorescence techniques:

    • Fix tissues with 4% paraformaldehyde for 2-4 hours at room temperature

    • Permeabilize with 0.1% Triton X-100 for cytoplasmic domains or 0.5% saponin for intraluminal epitopes

    • Use fluorophore-conjugated secondary antibodies for signal amplification

  • Advanced techniques for submicron resolution:

    • Super-resolution microscopy (STED, PALM, or STORM) to resolve membrane microdomain localization

    • Correlative light and electron microscopy (CLEM) to simultaneously visualize membrane ultrastructure

  • Live imaging approaches:

    • Use transgenic lines expressing GFP-tagged tmem85 under tissue-specific promoters

    • Employ two-photon microscopy for deeper tissue penetration in intact tadpoles

    • Apply fluorescence recovery after photobleaching (FRAP) to assess protein mobility

These techniques provide complementary information about tmem85 localization at different scales and temporal resolutions, from whole-organism to subcellular compartments.

How does probiotic colonization affect transmembrane protein expression in Xenopus laevis skin?

Recent research reveals complex interactions between microbial colonization and host membrane protein expression in Xenopus laevis skin. When probiotic bacteria (including Pseudomonas and Stenotrophomonas species) colonize X. laevis skin, they cause significant short-term alterations in both microbial community composition and host immune gene expression . These effects are most pronounced at one week post-exposure and decrease thereafter, suggesting a transient response .

Methodologically, researchers can study these interactions by:

  • Applying specific bacterial strains (as monocultures or cocktails) to X. laevis skin

  • Quantifying microbial community changes using 16S rRNA gene sequencing

  • Analyzing host gene expression through RT-qPCR and skin transcriptomics over defined time periods

  • Correlating changes in membrane protein expression with microbial community shifts

For transmembrane proteins specifically, researchers observed that probiotic colonization by Pseudomonas strain RSB5.4 reduced expression of regulatory T cell marker (FOXP3) and caused significant gene expression changes in membrane-associated proteins . This research approach helps elucidate the microbiome-immune interface underlying disease dynamics and evolutionary processes, with transmembrane proteins serving as key mediators of these interactions.

What are the comparative advantages of using X. laevis versus X. tropicalis for tmem85 genetic studies?

The choice between Xenopus laevis and Xenopus tropicalis for transmembrane protein genetic studies depends on experimental priorities and should be based on their distinct genetic characteristics:

FeatureXenopus laevisXenopus tropicalisImplications for tmem85 Research
PloidyTetraploid (N=18)Diploid (N=10)Simpler genetic manipulation in X. tropicalis
Genome Size3.1×10^9 bp1.5×10^9 bpFaster genome scanning and mutation identification in X. tropicalis
Generation Time1-2 years4-6 monthsMore rapid genetic crosses in X. tropicalis
Egg Size/NumberLarger/MoreSmaller/FewerGreater biochemical sample availability in X. laevis
AlloallelesPresentAbsentRedundancy challenges in X. laevis requiring targeting multiple loci
Established TechniquesExtensiveGrowingMore published protocols for X. laevis expression studies

X. tropicalis offers advantages for loss-of-function genetics and enhanced genomics, with simpler interpretation of knockout phenotypes due to its canonical diploid genome organization . This makes it particularly suitable for CRISPR-Cas9 or TILLING approaches to tmem85 modification. Meanwhile, X. laevis remains valuable for biochemical assays, protein overexpression, and detailed phenotypic analyses due to its larger size and established experimental protocols . For comprehensive studies, some laboratories maintain both species, using X. tropicalis for genetic analysis and X. laevis for biochemical and functional characterization of the identified variants.

How can CRISPR-Cas9 be optimized for targeted modification of tmem85 in Xenopus?

Optimizing CRISPR-Cas9 for transmembrane protein modification in Xenopus requires consideration of several key factors to maximize editing efficiency while minimizing off-target effects:

  • Guide RNA design strategy:

    • Target regions with high conservation between X. laevis alloalleles if present

    • Select gRNAs with predicted high efficiency (>60%) using algorithms adapted for Xenopus

    • For transmembrane proteins, target early exons or critical functional domains

    • Validate gRNA efficiency using in vitro digestion assays before embryo injection

  • Delivery protocol:

    • Inject 500-800 pg Cas9 protein with 200-300 pg sgRNA into one-cell stage embryos

    • For X. laevis, inject 4-6 nl; for X. tropicalis, inject 2-3 nl

    • Target F0 mosaic animals for initial phenotypic assessment

    • Raise F0 founders to sexual maturity for germline transmission

  • Validation methods:

    • Screen F0 embryos using T7 endonuclease I assay on PCR amplicons of target region

    • Confirm mutations by Sanger sequencing of cloned PCR products

    • For transmembrane proteins, verify altered expression by immunostaining or Western blot

    • Assess functional consequences through electrophysiology or trafficking assays

  • Specificity considerations:

    • Perform whole genome sequencing on F1 animals to detect off-target modifications

    • Use paired nickase approach for increased specificity in critical applications

    • Include control injections with non-targeting gRNAs to establish baseline phenotypes

This optimized approach enables precise modification of tmem85 or other transmembrane proteins while maintaining the experimental advantages of the Xenopus system.

What strategies help distinguish between redundant paralogs of transmembrane proteins in X. laevis?

Distinguishing between redundant paralogs of transmembrane proteins in Xenopus laevis presents a significant challenge due to its pseudotetraploid genome and the presence of alloalleles with potential functional overlap . Researchers can employ the following methodological approaches:

  • Sequence-based differentiation:

    • Perform phylogenetic analysis to identify divergent regions between paralogs

    • Design paralog-specific primers for RT-qPCR quantification of individual transcripts

    • Use RNA-seq with computational deconvolution to measure relative expression levels

  • Targeted genetic manipulation:

    • Design CRISPR-Cas9 guides specific to each paralog by targeting divergent sequences

    • Validate specificity through sequencing of targeted loci

    • Generate single and double knockout lines to assess functional redundancy

  • Protein-level discrimination:

    • Develop paralog-specific antibodies targeting divergent epitopes

    • Perform immunoprecipitation followed by mass spectrometry for protein identification

    • Use epitope tagging of individual paralogs in transgenic lines

  • Functional analysis:

    • Express individual paralogs in Xenopus oocytes for electrophysiological characterization

    • Perform rescue experiments with paralog-specific constructs in knockout backgrounds

    • Conduct domain-swapping experiments to identify functionally distinct regions

These approaches enable researchers to dissect the potentially distinct roles of transmembrane protein paralogs that arose during X. laevis' evolutionary history as an allotetraploid organism.

How should controls be designed for tmem85 overexpression studies in Xenopus?

Robust control design is critical for interpreting transmembrane protein overexpression studies in Xenopus systems. A comprehensive control strategy includes:

  • Expression-level controls:

    • Inject mRNA encoding a non-functional mutant tmem85 at identical concentration

    • Include dose-response series (25%, 50%, 100%, 150% of experimental dose)

    • Normalize expression across experiments using co-injected lineage tracers

  • Specificity controls:

    • Test rescue of phenotypes with RNAi-resistant constructs

    • Include related transmembrane proteins from the same family

    • Design chimeric constructs with domain swaps to identify functional regions

  • Technical controls:

    • Use eggs/embryos from multiple females to account for clutch-specific effects

    • Include injection site controls (animal vs. vegetal pole, unilateral vs. bilateral)

    • Perform parallel injections in both X. laevis and X. tropicalis for cross-validation

  • Data validation controls:

    • Quantify protein expression levels via Western blot with standard curves

    • Verify membrane localization through subcellular fractionation

    • Assess secondary effects on other membrane proteins through proteomics

What approaches help resolve contradictory data about tmem85 function?

When faced with contradictory data regarding transmembrane protein function in Xenopus systems, a systematic troubleshooting approach includes:

  • Technical validation:

    • Verify reagent quality through independent batches and suppliers

    • Confirm protein expression and localization using multiple detection methods

    • Retest phenotypes with alternative experimental approaches (e.g., morpholinos vs. CRISPR)

  • Genetic background assessment:

    • Test effects in different Xenopus strains or isogenetic backgrounds

    • Compare results between X. laevis and X. tropicalis to identify species-specific effects

    • Consider potential alloallele compensation in X. laevis through targeted analysis of both copies

  • Developmental timing analysis:

    • Perform time-course experiments to capture transient phenotypes

    • Utilize conditional expression systems for stage-specific perturbation

    • Track protein dynamics through development using photoconvertible fusion tags

  • Interaction network mapping:

    • Identify potential binding partners through co-immunoprecipitation

    • Characterize signaling pathways using specific inhibitors or activators

    • Perform genetic interaction studies with known pathway components

  • Environmental variable control:

    • Standardize housing conditions (temperature, light cycles, water quality)

    • Control for microbial exposure, as this can affect skin membrane protein expression

    • Document seasonal variations that might influence experimental outcomes

By systematically addressing these factors, researchers can resolve apparent contradictions and develop a more nuanced understanding of transmembrane protein function in different contexts.

How can researchers minimize off-target effects when manipulating tmem85 expression?

Minimizing off-target effects during transmembrane protein manipulation in Xenopus requires a multi-faceted approach:

  • Design optimization:

    • For morpholinos, verify specificity through BLAST against the Xenopus genome

    • Test multiple non-overlapping morpholinos targeting different regions

    • For CRISPR-Cas9, select guide RNAs with minimal predicted off-targets

    • Validate guide RNA specificity through genome-wide binding assays

  • Dosage calibration:

    • Establish dose-response curves to identify minimal effective concentrations

    • Use translation-blocking morpholinos at 1-5 ng and splice-blocking at 5-10 ng

    • For CRISPR-Cas9, limit Cas9 protein to 500-800 pg per embryo

    • With mRNA overexpression, stay within physiological range when possible

  • Validation requirements:

    • Demonstrate target protein reduction through Western blot or immunostaining

    • Perform rescue experiments with constructs resistant to knockdown

    • Compare phenotypes between morpholino and genetic knockout approaches

    • Sequence potential off-target sites identified by in silico prediction tools

  • Control integration:

    • Include standard control morpholino injections at equivalent concentrations

    • For CRISPR-Cas9, use non-targeting guide RNA as negative control

    • Always include uninjected siblings from the same clutch as reference

    • When available, compare with established mutant lines as "gold standard"

This comprehensive strategy reduces the likelihood of misinterpreting results due to off-target effects, increasing confidence in the specificity of observed phenotypes to tmem85 manipulation.

How can single-cell approaches advance understanding of tmem85 expression heterogeneity?

Single-cell technologies offer unprecedented insights into transmembrane protein expression heterogeneity across tissues and developmental stages in Xenopus:

  • scRNA-seq methodology for Xenopus:

    • Dissociate embryos or tissues using gentle enzymatic treatment (TrypLE, 10-15 minutes)

    • Filter cell suspensions through 40μm strainers to remove debris

    • Verify cell viability (>85%) before proceeding to library preparation

    • Process using 10x Genomics Chromium or Drop-seq platforms

    • Sequence to minimum depth of 50,000 reads per cell

  • Spatial transcriptomics integration:

    • Combine scRNA-seq with spatial techniques like Visium or MERFISH

    • Create reference maps of transmembrane protein expression across intact tissues

    • Correlate expression patterns with anatomical features and cell interactions

  • Analytical approaches:

    • Apply trajectory inference algorithms to map developmental regulation

    • Identify cell populations with coordinated transmembrane protein expression

    • Detect rare cell types with specialized membrane protein profiles

    • Correlate transmembrane protein expression with pathway activity

  • Functional validation:

    • Target identified cell populations using cell type-specific promoters

    • Perform CRISPR-based lineage tracing of cells expressing target proteins

    • Validate protein-level heterogeneity through multiplexed immunofluorescence

This integrated approach reveals how transmembrane protein expression varies at single-cell resolution, providing insights into functional specialization and regulation that would be masked in bulk analyses.

What are promising directions for applying findings from Xenopus tmem85 research to human disease models?

Translating transmembrane protein research from Xenopus to human disease models leverages the evolutionary conservation of fundamental cellular mechanisms while addressing species-specific adaptations:

  • Disease-relevant comparative genomics:

    • Identify conserved domains between Xenopus and human transmembrane proteins

    • Map human disease mutations onto homologous Xenopus proteins

    • Assess functional conservation through cross-species rescue experiments

    • Generate humanized Xenopus models expressing human variants

  • Drug discovery applications:

    • Screen compound libraries using Xenopus embryos expressing fluorescent reporters

    • Validate hits through electrophysiological recording from oocytes expressing tmem85

    • Assess efficacy and toxicity profiles in developing embryos

    • Identify conserved drug binding sites through structure-function studies

  • Translational research workflow:

    • Characterize transmembrane protein function in Xenopus

    • Validate findings in mammalian cell cultures

    • Establish mouse models for in vivo validation

    • Develop therapeutic approaches based on conserved mechanisms

  • Emerging approaches:

    • Employ organoid systems derived from both Xenopus and human tissues

    • Utilize CRISPR-based screening to identify genetic modifiers in both systems

    • Apply systems biology approaches to model pathway conservation and divergence

These translational strategies maximize the utility of Xenopus findings for human health applications while acknowledging the biological differences between amphibian and mammalian systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.