Recombinant Xenopus laevis Transmembrane protein 93 (tmem93)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xenopus laevis Transmembrane Protein 93 (TMEM93)

Recombinant Xenopus laevis Transmembrane Protein 93 (TMEM93), also known as ER membrane protein complex subunit 6 (EMC6), is a multipass transmembrane protein critical for the biogenesis and stabilization of membrane proteins in the endoplasmic reticulum (ER). It is a component of the conserved ER membrane protein complex (EMC), which facilitates the insertion and folding of challenging transmembrane domains (TMDs) enriched in polar or charged residues .

Example Workflow

  1. Expression: Inject tmem93 mRNA into Xenopus oocytes for functional studies .

  2. Purification: Use His-tag affinity chromatography for recombinant protein isolation .

  3. Analysis: SDS-PAGE to confirm size (~12.5 kDa predicted for 110aa; actual MW may vary with tags) .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; aliquoting is recommended .

  • Species-Specific Variants: X. tropicalis and human homologs (e.g., Q9BV81) differ in sequence and function .

  • Therapeutic Potential: EMC6/TMEM93 modulates autophagy in glioblastoma, suggesting cancer therapeutic targets .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
emc6; tmem93; ER membrane protein complex subunit 6; Transmembrane protein 93
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
emc6
Target Protein Sequence
MAGVALKREGPQFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTSLYGFIFYFLASF LLSLLLVLKSGRKWNKYFKSRKPLFTGGLVGGLFTYVLFWTFLYGMVHVY
Uniprot No.

Target Background

Function

Transmembrane protein 93 (TMEM93) is a component of the endoplasmic reticulum membrane protein complex (EMC). It facilitates the energy-independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum. TMEM93 preferentially accommodates proteins with weakly hydrophobic transmembrane domains or those containing destabilizing features such as charged and aromatic residues. It participates in the co-translational insertion of multi-pass membrane proteins, where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. TMEM93 is also crucial for the post-translational insertion of tail-anchored (TA) proteins into the ER membrane. By mediating the correct co-translational insertion of N-terminal transmembrane domains in an N-exo topology (with the translocated N-terminus in the ER lumen), it controls the topology of multi-pass membrane proteins, such as G protein-coupled receptors. Through its regulation of protein membrane insertion, TMEM93 indirectly influences numerous cellular processes.

Database Links

KEGG: xla:447382

UniGene: Xl.10119

Protein Families
EMC6 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Xenopus laevis tmem93 and why is it significant for research?

Transmembrane protein 93 (tmem93) in Xenopus laevis is a membrane-spanning protein that likely plays a role in cellular signaling or transport. While not extensively characterized in the provided literature, transmembrane proteins in Xenopus are significant for developmental and comparative biology research. Xenopus laevis serves as an excellent model organism for protein studies due to the large amount of material that can be easily obtained from eggs and embryos, providing sufficient protein for deep proteomic experiments (>100 μg) . The significance of studying transmembrane proteins in Xenopus extends to understanding fundamental developmental processes, as many of these proteins participate in signaling pathways critical for embryogenesis.

What expression patterns does tmem93 show during Xenopus development?

While the specific expression pattern of tmem93 is not directly detailed in the provided literature, transmembrane proteins in Xenopus often show tissue-specific expression patterns during development. Based on research on other Xenopus proteins, expression patterns can range from ubiquitous distribution with enrichment in neural tube and somites to highly specific patterns in selected tissues . To determine the expression pattern of tmem93, researchers would typically employ in situ hybridization using stage-specific embryos according to the Nieuwkoop and Faber (1994) normal table, examining expression from early neural plate through later developmental stages . This methodology would reveal whether tmem93 follows expression patterns similar to other transmembrane or RNA-binding proteins that show neural tube, neural crest, or somitic expression.

How can I extract and purify recombinant tmem93 from Xenopus laevis tissues?

For extracting transmembrane proteins like tmem93 from Xenopus tissues, researchers can employ either Trizol extraction or bead beating methods. The Trizol method has been successfully used to extract proteins from Xenopus skin tissue for subsequent analysis . For transmembrane proteins specifically, the protocol typically involves:

  • Tissue homogenization in Trizol reagent

  • Phase separation (aqueous and organic phases)

  • Protein precipitation from the organic phase using isopropanol

  • Multiple wash steps to remove contaminants

  • Solubilization of the protein pellet in a buffer containing mild detergents suitable for transmembrane proteins

After extraction, proteins can be further purified using solid phase extraction with either C8 or C18 columns, with the choice depending on the hydrophobicity of the target protein . For transmembrane proteins like tmem93, C18 columns might provide better retention due to the hydrophobic nature of membrane-spanning domains.

What are the best methods for detecting tmem93 in Xenopus samples?

For detecting transmembrane proteins like tmem93 in Xenopus samples, tandem mass spectrometry (MS/MS) represents the state-of-the-art approach. This method allows for both identification and quantification of proteins with high sensitivity. The workflow typically involves:

  • Protein extraction from tissue samples

  • Enzymatic digestion (typically using LysC and Trypsin)

  • Optional fractionation using medium pH reverse-phase columns to increase coverage

  • LC-MS analysis with Multi-Notch MS³ quantification for precise measurements

  • Data analysis using appropriate protein databases

For Xenopus proteins, researchers have successfully used this approach to identify over 14,000 proteins with high confidence . When analyzing transmembrane proteins specifically, modified protocols that account for their hydrophobic nature may be necessary, including the use of specialized detergents during extraction and alternative digestion strategies to improve coverage of membrane-spanning regions.

How does the abundance of tmem93 correlate with its mRNA levels during Xenopus development?

Understanding the correlation between protein abundance and mRNA levels for transmembrane proteins like tmem93 requires integrated transcriptomic and proteomic approaches. Research in Xenopus has shown that the correlation between mRNA and protein abundance is relatively weak (Pearson correlation of 0.32, Spearman correlation of 0.30 in log-log space) . This suggests that post-transcriptional regulation likely plays a significant role in determining protein levels.

To investigate this correlation for tmem93 specifically, researchers should:

  • Perform RNA-seq to quantify tmem93 transcript levels at various developmental stages

  • Conduct parallel proteomics analysis to measure tmem93 protein abundance

  • Calculate correlation coefficients between transcript and protein levels

  • Analyze potential regulatory mechanisms that might explain discrepancies

It's important to note that the likelihood of detecting a protein increases with mRNA abundance, though the correlation is not strong, especially in eggs which emerge with a potentially different proteome and transcriptome after maturation .

What techniques can be used to study the post-translational modifications of tmem93?

Post-translational modifications (PTMs) of transmembrane proteins can be studied using a combination of enrichment strategies and mass spectrometry analysis. For phosphorylation, which is one of the most common PTMs, the following approach has been successfully applied to Xenopus proteins:

  • Protein extraction and digestion with proteases (typically LysC and trypsin)

  • Labeling with tandem mass tag reagents (TMT) for quantitative analysis

  • Enrichment of phosphorylated peptides using immobilized metal affinity chromatography (IMAC)

  • LC-MS/MS analysis with Multi-Notch MS³ quantification

  • Data analysis to identify phosphorylation sites and estimate site occupancy

This approach has allowed researchers to identify over 6,700 phospho-forms across approximately 3,000 proteins in Xenopus . For tmem93 specifically, this method could reveal potential regulatory phosphorylation sites that might influence protein function, localization, or stability during development.

How can I design an expression cloning screen to identify tmem93 function in Xenopus?

Expression cloning screens have proven valuable for identifying gene functions in Xenopus development. To design a screen focusing on tmem93, you could follow this methodology:

  • Construct a neural plate or relevant tissue-specific cDNA library, as was done successfully for identifying RNA-binding proteins in Xenopus

  • Clone tmem93 and prepare mRNA for microinjection

  • Inject synthetic mRNA into early embryos (typically at the 1-2 cell stage)

  • Analyze phenotypes by:

    • In situ hybridization for regional neural markers and differentiation markers

    • Examination of morphological changes at later stages (approximately stage 39)

    • Assessment of specific developmental processes relevant to membrane proteins

Phenotypes to monitor would include axis defects, neural plate mispatterning, and abnormalities in tissue-specific structures, similar to those observed with RNA-binding proteins that affected neural plate patterning or tadpole morphology .

What are the challenges in studying tmem93 interactions with other proteins in Xenopus?

Studying protein-protein interactions involving transmembrane proteins presents several challenges. Based on approaches used for other Xenopus proteins, researchers can address these challenges through:

  • Co-immunoprecipitation coupled to mass spectrometry (co-IP-MS) in appropriate extracts, as demonstrated for identifying Yap-interacting proteins in S-phase egg extracts

  • Validation of interactions through reciprocal co-IP assays

  • Confirmation of interactions using heterologous expression systems (e.g., tagged proteins in HEK293 cells)

When working with transmembrane proteins specifically, additional considerations include:

  • Using appropriate detergents that solubilize membrane proteins without disrupting interactions

  • Employing crosslinking strategies to capture transient interactions

  • Considering membrane microdomains that might influence interaction dynamics

The challenges involve maintaining the native conformation of transmembrane domains while solubilizing the protein sufficiently for immunoprecipitation and subsequent analysis.

How can CRISPR-Cas9 genome editing be optimized for studying tmem93 function in Xenopus laevis?

CRISPR-Cas9 genome editing in Xenopus laevis presents unique challenges due to its allotetraploid genome. For studying tmem93 function, a comprehensive approach would include:

  • Careful design of guide RNAs targeting conserved regions across homeologous copies of tmem93

  • Validation of guide RNA efficiency using in vitro cleavage assays

  • Microinjection of Cas9 protein and guide RNAs into fertilized eggs at the one-cell stage

  • Screening for mutations using T7 endonuclease assays, high-resolution melting analysis, or direct sequencing

  • Establishment of F0 mosaic animals and subsequent breeding to generate stable lines

An alternative approach for rapid functional analysis would be to combine the Trim-Away technique (for depleting maternal protein) with morpholino injections (to prevent de novo synthesis), as demonstrated for other Xenopus proteins . This combination allows for efficient depletion of maternal protein stockpiles while preventing their de novo synthesis before the mid-blastula transition (MBT).

What strategies can resolve contradictory data on tmem93 function between in vitro and in vivo Xenopus systems?

Resolving contradictions between in vitro and in vivo results requires a multi-faceted approach:

  • Perform detailed temporal analysis of tmem93 expression and function throughout development

  • Compare protein interaction networks in different contexts using co-IP-MS in both egg extracts and embryonic tissues

  • Validate key findings using multiple experimental approaches:

    • Loss-of-function studies (morpholinos, CRISPR-Cas9)

    • Gain-of-function studies (mRNA overexpression)

    • Rescue experiments with mutant variants

  • Consider post-translational modifications that might differ between systems

  • Account for developmental stage-specific effects, as proteome dynamics change significantly during development

It's important to recognize that Xenopus egg extracts possess little or no intrinsic transcriptional activity but strongly support translation and post-translational modifications , which may lead to differences compared to the in vivo context where transcriptional regulation is active.

How can phosphoproteomics be applied to understand tmem93 regulation during critical developmental transitions?

Phosphoproteomics offers powerful insights into protein regulation during development. For studying tmem93 phosphorylation:

  • Collect samples across key developmental timepoints, particularly before and after the mid-blastula transition (MBT)

  • Perform phosphopeptide enrichment using IMAC following protein extraction and digestion

  • Use TMT labeling for quantitative comparison across timepoints

  • Analyze data to identify phosphorylation sites and temporal patterns

  • Create a pipeline for identifying homologous human phosphorylations for cross-species comparison

  • Estimate phosphorylation site occupancy where possible

Research has shown that significant phosphorylation changes are concentrated in the very early stages of Xenopus development, while protein changes are more prominent later in development . Understanding how tmem93 phosphorylation changes across these transitions could reveal regulatory mechanisms controlling its function.

What are the methodological considerations for studying tmem93 in different cellular compartments during Xenopus development?

Studying the subcellular localization and compartment-specific functions of transmembrane proteins requires specialized approaches:

  • Generate fluorescently tagged tmem93 constructs for live imaging studies

  • Perform subcellular fractionation to isolate different membrane compartments

  • Use immunohistochemistry with specific antibodies against tmem93

  • Employ proximity labeling techniques (BioID or APEX) to identify compartment-specific interaction partners

  • Consider temporal dynamics, as protein localization may change during development

A particular challenge with transmembrane proteins is distinguishing between functional pools in different compartments. This requires careful biochemical separation techniques and validation using multiple approaches. Additionally, considerations should be made for potential effects of tagging on protein localization and function, especially for transmembrane domains that might be sensitive to structural modifications.

What are the future directions for tmem93 research in Xenopus models?

Future research on tmem93 in Xenopus should focus on integrating multiple omics approaches to understand its function in a developmental context. Key directions include:

  • Comprehensive characterization of tmem93 expression patterns across developmental stages

  • Identification of interaction partners through proteomics approaches

  • Functional studies using CRISPR-Cas9 and other gene editing technologies

  • Investigation of post-translational modifications and their functional significance

  • Comparative studies between Xenopus and other model organisms to identify conserved functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.