Recombinant Xenopus laevis Trimeric intracellular cation channel type B-A (tmem38b-a)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Molecular Features of Recombinant tmem38b-a

PropertyDetails
Gene Nametmem38b-a (Xenopus laevis)
Protein Length284 amino acids
Host Expression SystemE. coli (cell-free expression)
Purity≥85% (SDS-PAGE verified)
TagN-terminal His-tag
UniProt IDQ3KQE5
Key MotifKEVXRXXK (pore-forming domain)

Recombinant Expression and Purification

Recombinant tmem38b-a is produced using heterologous expression systems, primarily E. coli, to ensure high yield and purity :

  • Expression: Full-length protein (residues 1–284) is synthesized in E. coli and purified via affinity chromatography.

  • Applications: Used in structural studies (e.g., X-ray crystallography) , electrophysiological assays , and disease modeling (e.g., osteogenesis imperfecta) .

4.1. Role in Osteogenesis Imperfecta (OI)

Mutations in TMEM38B (the human ortholog of tmem38b-a) cause autosomal recessive OI type XIV, characterized by bone fragility and defective collagen maturation . Key mechanisms include:

  • ER Calcium Dysregulation: TRIC-B deficiency disrupts ER calcium flux, leading to delayed procollagen folding and increased ER stress .

  • Collagen Defects: Reduced collagen secretion (50–70%) and abnormal post-translational modifications (e.g., altered lysine hydroxylation) .

Table 2: Reported TMEM38B Mutations and Phenotypic Effects

MutationConsequenceClinical Phenotype
c.455-7T>G (splicing)Two-amino-acid insertion (p.R151_G152insVL)Mild bone deformities, growth retardation
c.507G>A (nonsense)Premature stop codon (p.W169X)Recurrent fractures, low bone mass
c.455_542delFrameshift (p.Gly152Alafs*5)Severe OI with respiratory complications

4.2. Model Organism Studies

  • Zebrafish: tmem38b mutants exhibit skeletal defects, reduced vertebrae size, and delayed swim bladder development, mirroring human OI pathology .

  • Mice: Tmem38b knockout models show perinatal lethality due to respiratory failure, highlighting TRIC-B’s role in lung function .

Applications in Biomedical Research

  • Drug Discovery: Screening for TRIC-B modulators to address ER calcium dysregulation in OI .

  • Structural Biology: Cryo-EM and crystallography studies to elucidate gating mechanisms .

  • Gene Therapy: CRISPR-based correction of TMEM38B mutations in patient-derived cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please specify it in your order; we will prioritize your request.
Synonyms
tmem38b-a; Trimeric intracellular cation channel type B-A; TRIC-B-A; TRICB-A; Transmembrane protein 38B-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem38b-a
Target Protein Sequence
MESLSELSVQFSQLSMFPFFDMAHYVVSVMSAREQAGALDIAARSPMASWFSAMLYCFGG GILSSILLAEPPIAVLSNTTNIMLASTIWYMVYYFPYDLFYNCFFFLPIRLIIAGMKEVT RTWKILSGVTHAHSHYKDALLVMITIGWARGAGGGLISNFEQLVRGVWKPESNEFLKMSY PVKVTLIGAVLFTLQHGHYLPISRHNLMLIYTMFLVLIKVTMMLTHSTASPFLPLETPLQ RILFGQRQKPSEVRQSASSSGAKGKPSKKTLDKDSGEQSKKKDS
Uniprot No.

Target Background

Function

Function: A monovalent cation channel crucial for maintaining rapid intracellular calcium release. It may also function as a potassium counter-ion channel, coordinating with calcium release from intracellular stores.

Database Links

KEGG: xla:446269

UniGene: Xl.15857

Protein Families
TMEM38 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is tmem38b-a and what is its primary function in Xenopus laevis?

Tmem38b-a is a trimeric intracellular cation channel type B-A protein found in Xenopus laevis. It functions as a key regulator of calcium flux across cellular membranes, particularly in the endoplasmic reticulum. The full-length protein consists of 284 amino acids and is available as a recombinant protein with a His-tag for research purposes . The primary function of tmem38b-a involves maintaining calcium homeostasis, which is critical for various developmental processes including proper collagen synthesis and bone formation .

How is Xenopus laevis tmem38b-a relevant to human disease research?

Xenopus laevis tmem38b-a serves as an excellent model for studying human TMEM38B-related disorders. Mutations in human TMEM38B are associated with autosomal recessive osteogenesis imperfecta type XIV, a form of brittle bone disease . Research has revealed that TMEM38B gene mutations can significantly affect calcium signaling, collagen post-translational modification, and proper bone development . Xenopus laevis provides an advantageous model system for studying these mechanisms due to the ease of genetic manipulation and the ability to observe developmental processes in real-time .

What cellular pathways involve tmem38b-a?

Tmem38b-a is primarily involved in calcium signaling pathways within the cell. It regulates calcium release from the endoplasmic reticulum, which affects multiple downstream processes . Disruption of tmem38b function leads to impaired calcium flux, which in turn affects:

  • Collagen type I post-translational modification and processing

  • ER stress response pathways

  • Cell differentiation, particularly in osteoblasts

  • Proper mineralization of skeletal tissues

  • Neural crest cell migration

Studies in various models have shown that tmem38b deficiency results in enlarged ER cisternae and abnormal extracellular collagen fiber content .

What methods are most effective for studying tmem38b-a function in Xenopus laevis?

Several methodological approaches are particularly effective for studying tmem38b-a:

  • Genetic manipulation techniques:

    • Morpholino oligonucleotide-mediated knockdown: Can be designed to block tmem38b-a translation or splicing

    • CRISPR/Cas9 gene editing: Allows for precise knockout or mutation of tmem38b-a

    • Transgenic approaches: Nuclei from transfected cells can be transplanted into unfertilized eggs to generate transgenic embryos expressing modified versions of tmem38b-a

  • Expression analysis methods:

    • Whole-mount in situ hybridization: For visualizing spatial expression patterns during development

    • RT-qPCR: For quantitative analysis of tmem38b-a expression levels

  • Functional assays:

    • Calcium flux measurements using fluorescent indicators

    • Collagen analysis via biochemical and imaging approaches

    • Alkaline phosphatase assays to assess osteoblast function

How can I design effective CRISPR/Cas9 experiments to manipulate tmem38b-a in Xenopus?

Designing effective CRISPR/Cas9 experiments for tmem38b-a requires careful consideration of several factors:

  • sgRNA design considerations:

    • Target early exons (such as exon 1-2 boundary) to ensure complete loss of function

    • Design multiple sgRNAs to increase chances of successful editing and to validate phenotypes

    • Verify target specificity to minimize off-target effects

  • Validation strategies:

    • Generate more than one mutant line with different sgRNAs targeting tmem38b-a

    • Perform dose-dependency experiments

    • Conduct rescue experiments by co-injecting mRNA that is not targeted by the CRISPR system

  • Phenotypic analysis:

    • Compare phenotypes with morpholino-mediated knockdown to validate results

    • Analyze calcium signaling, collagen processing, and skeletal development in mutants

The CRISPR/Cas9 system has been proven highly effective in both Xenopus tropicalis and Xenopus laevis, with minimal off-target effects when properly designed .

What are the recommended approaches for analyzing calcium flux alterations in tmem38b-a mutants?

Given the central role of tmem38b-a in calcium regulation, analyzing calcium flux is critical:

  • In vitro approaches:

    • Isolate cells or tissues from wild-type and tmem38b-a mutant embryos

    • Load cells with calcium-sensitive fluorescent dyes (e.g., Fluo-4, Fura-2)

    • Measure baseline calcium levels and responses to stimuli using fluorescence microscopy or plate readers

    • Quantify parameters including amplitude, frequency, and duration of calcium transients

  • In vivo approaches:

    • Generate transgenic lines expressing genetically encoded calcium indicators (GECIs)

    • Perform live imaging of calcium dynamics in developing embryos

    • Compare wild-type and tmem38b-a mutant calcium signaling patterns during development

  • Pharmacological interventions:

    • Test responses to calcium channel blockers or activators

    • Assess ER calcium store depletion using thapsigargin or similar agents

    • Evaluate store-operated calcium entry pathways

Studies have demonstrated that TMEM38B-deficient cells show significantly impaired calcium flux, which directly correlates with defects in collagen processing and mineralization .

How does tmem38b-a contribute to modeling osteogenesis imperfecta (OI)?

Xenopus laevis tmem38b-a provides a valuable model for studying OI type XIV through several mechanisms:

  • Phenotypic relevance:

    • Disruption of tmem38b-a leads to skeletal abnormalities reminiscent of human OI

    • Impaired collagen type I processing mimics the molecular pathology of OI

  • Experimental advantages:

    • Ability to generate large numbers of embryos for high-throughput analysis

    • Transparency of embryos allows for real-time visualization of development

    • Established methods for skeletal staining and analysis

  • Molecular insights:

    • Studies in tmem38b-deficient models have revealed that this gene accounts for approximately one-third of autosomal recessive OI cases in certain populations

    • Research shows that tmem38b mutation leads to specific collagen abnormalities and ER stress, providing insights into disease mechanisms

These models enable researchers to test potential therapeutic interventions and study the fundamental mechanisms of bone development and disease.

What skeletal phenotypes are observed in tmem38b-a-deficient Xenopus models?

Tmem38b-a deficiency leads to specific skeletal abnormalities that can be characterized through various methods:

  • Morphological changes:

    • Reduced mineralization of skeletal elements

    • Abnormal bone structure and potential fractures

    • Delayed ossification

  • Cellular defects:

    • Abnormal osteoblast differentiation and function

    • Reduced alkaline phosphatase activity

    • Delayed mineralization in cell cultures and in vivo

  • Extracellular matrix abnormalities:

    • Altered collagen fiber organization

    • Changes in extracellular matrix composition

    • Defects in collagen cross-linking and stability

These phenotypes can be assessed using techniques such as alizarin red/alcian blue staining, micro-computed tomography, and histological analysis, similar to methods used in zebrafish tmem38b models .

How do tmem38b-a mutations affect neural crest cell migration and craniofacial development?

Neural crest cells (NCCs) are crucial for craniofacial development, and tmem38b-a mutations may affect their migration and function:

  • Migration analysis techniques:

    • Whole-mount in situ hybridization using NCC markers like xTWIST can reveal migration patterns in vivo

    • Measurements of pharyngeal arch length and area can quantify migration defects

    • In vitro NCC explant cultures allow for direct observation of migration behaviors

  • Specific parameters to measure:

    • Velocity and dispersion of NCCs using time-lapse confocal microscopy

    • Directional migration in chemotaxis assays

    • Formation and patterning of pharyngeal arches

  • Mechanistic considerations:

    • Calcium signaling plays a crucial role in NCC migration

    • Extracellular matrix composition, which is affected by tmem38b-a deficiency, influences NCC movement

    • Cytoskeletal dynamics required for migration depend on proper calcium regulation

These approaches have been successfully used in Xenopus to test how knockdown of disease-associated genes affects NCC migration both in vivo and in vitro .

What is the relationship between tmem38b-a and collagen type I synthesis and processing?

The relationship between tmem38b-a and collagen type I involves several interconnected mechanisms:

  • Post-translational modifications:

    • Tmem38b-a maintains proper calcium levels required for optimal function of enzymes involved in collagen modification

    • Deficiency leads to reduced hydroxylation of specific proline residues in collagen chains

    • The prolyl 3-hydroxylation complex (consisting of P3H1, CRTAP, and CyPB) requires proper ER calcium levels for optimal function

  • Collagen folding and assembly:

    • Calcium-dependent chaperones are critical for proper collagen triple helix formation

    • Disrupted calcium homeostasis affects the function of these chaperones

    • Studies show that tmem38b-deficient cells produce collagen with abnormal post-translational modifications

  • Secretion and extracellular processing:

    • Calcium signaling regulates vesicular trafficking and secretion pathways

    • Extracellular organization of collagen fibers is affected in tmem38b mutants

    • Analysis of collagen from tmem38b mutant zebrafish reveals alterations in fiber content and organization

These mechanisms help explain why tmem38b mutations result in osteogenesis imperfecta, as proper collagen synthesis is essential for bone strength and integrity.

How do calcium flux abnormalities in tmem38b-a mutants affect cellular stress responses?

Calcium flux abnormalities in tmem38b-a mutants trigger specific cellular stress responses:

  • ER stress activation:

    • Impaired calcium release from the ER disrupts protein folding capacity

    • This leads to accumulation of unfolded or misfolded proteins (particularly collagen)

    • Activation of the unfolded protein response (UPR) ensues

  • Molecular markers of stress:

    • Increased expression of ER stress markers such as hspa5 (BiP) has been observed in tmem38b mutants

    • Upregulation of molecular chaperones like Hsp47 (a collagen-specific chaperone) may occur

    • These markers can be assessed via RT-qPCR and immunohistochemistry

  • Morphological evidence:

    • Enlarged ER cisternae observed in tmem38b mutants indicate stress

    • These ultrastructural changes can be visualized using transmission electron microscopy

    • Histological analysis with toluidine blue staining can reveal cellular abnormalities

Understanding these stress responses provides insight into the cellular pathology of tmem38b-related disorders and may reveal potential therapeutic targets.

What comparative insights can be gained from studying tmem38b-a across different model organisms?

Comparative studies of tmem38b across model organisms provide valuable insights:

Model OrganismAdvantagesKey FindingsResearch Applications
Xenopus laevisLarge embryos, easy manipulation, external developmentImportant for early development, affects calcium signaling and collagen processingDevelopmental biology, disease modeling, high-throughput screening
ZebrafishTransparent embryos, genetic tractability, rapid developmentTwo tmem38b mutant lines show skeletal abnormalities, swim bladder defects, and altered collagen organization Drug screening, live imaging, regeneration studies
Mammalian cell cultureHuman relevance, controlled environmentTMEM38B KO cells show impaired calcium flux, reduced collagen post-translational modification, delayed differentiation and mineralization Molecular mechanism studies, drug testing
Mouse modelsMammalian physiology, genetic manipulationKnockout phenotypes include alveolar pathology and abnormal calcium signaling in cardiomyocytes Translational research, physiological studies

Cross-species comparisons reveal conserved functions in calcium regulation and collagen processing, while also highlighting species-specific differences in phenotypic manifestations. This comparative approach strengthens the validity of findings and their relevance to human disease.

What are the emerging therapeutic approaches for TMEM38B-related disorders?

Emerging therapeutic approaches for TMEM38B-related disorders focus on several strategies:

  • Targeting calcium homeostasis:

    • Calcium channel modulators that could compensate for tmem38b deficiency

    • Compounds that regulate store-operated calcium entry

    • Xenopus models provide an efficient system for screening such compounds

  • Addressing collagen processing:

    • Chemical chaperones that assist in proper collagen folding

    • Molecules that enhance post-translational modifications

    • Compounds that stabilize collagen fibrils

  • Gene therapy approaches:

    • Delivery of functional TMEM38B to affected tissues

    • CRISPR-based correction of mutations

    • Xenopus models can be used to test efficacy and safety of gene delivery methods

  • Cell-based therapies:

    • Stem cell transplantation to provide cells with functional TMEM38B

    • Engineered cell therapies that secrete proper extracellular matrix components

These approaches can be tested in Xenopus models, which offer advantages for high-throughput screening and rapid assessment of developmental effects.

What technological advances are enhancing tmem38b-a research in Xenopus models?

Recent technological advances have significantly enhanced tmem38b-a research:

  • Advanced genetic manipulation:

    • Improved CRISPR/Cas9 systems with higher efficiency and specificity

    • Base editing technologies for precise mutation creation

    • Inducible gene expression/knockout systems for temporal control

  • Imaging innovations:

    • Light sheet microscopy for high-resolution 3D imaging of developing embryos

    • Live calcium imaging with genetic indicators

    • Super-resolution microscopy for subcellular localization studies

  • Single-cell technologies:

    • Single-cell RNA sequencing to investigate cell-type-specific effects of tmem38b-a deficiency

    • Spatial transcriptomics to map expression patterns with high resolution

    • CRISPR screens in Xenopus for pathway discovery

  • In vivo biosensors:

    • Genetically encoded calcium indicators for real-time calcium dynamics

    • FRET-based sensors for monitoring protein-protein interactions

    • Tension sensors for measuring mechanical properties of developing tissues

These technologies allow for more sophisticated analysis of tmem38b-a function and provide new avenues for understanding disease mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.