Recombinant Xenopus laevis Trimeric intracellular cation channel type B-B (tmem38b-b)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

The protein is synthesized using multiple expression systems:

Host Systems and Purity

  • Primary Host: Cell-free expression systems (>85% purity by SDS-PAGE)

  • Alternative Systems: E. coli, yeast, baculovirus, or mammalian cells for full-length constructs

  • Tagging: N-terminal His-tag for affinity chromatography

Sequence and Stability

  • Full-Length Construct: Residues 1–284 with conserved pore-lining TM2 domain critical for ion conduction

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose; stable at -80°C

Calcium Homeostasis Role

  • TRIC-B facilitates K⁺ counterflux during IP₃R-mediated Ca²⁺ release, preventing ER membrane depolarization .

  • Knockout models show disrupted ER calcium flux kinetics, leading to ER stress and collagen misfolding .

Disease Relevance

  • Osteogenesis Imperfecta (OI): Null mutations in TMEM38B cause autosomal recessive OI due to dysregulated collagen post-translational modification .

  • Mechanism: Impaired TRIC-B function reduces Ca²⁺-dependent chaperone activity (e.g., FKBP65, PDI), resulting in 50–70% collagen secretion deficits .

Experimental Use Cases

  • Calcium Flux Assays: Used to study ER Ca²⁺ release kinetics in heterologous expression systems .

  • Collagen Studies: Models ER stress impacts on collagen hydroxylation and secretion .

  • Drug Screening: Target for compounds modulating calcium signaling pathways .

Limitations

  • Partial constructs (e.g., residues 1–240) lack functional TM3 domains, limiting ion channel activity studies .

Comparative Analysis with Orthologs

SpeciesProtein IdentityFunctional DivergenceDisease Association
Xenopus laevis100% (tmem38b-b)Dual homeologs (a/b) with tissue-specific rolesNot directly linked to OI
Human (TMEM38B)~75%Single isoform; stronger association with OIOsteogenesis imperfecta
Bovine (TMEM38B)~80%Conserved pore domainsNo reported pathologies

Key Research Findings

  • Structural Studies: TM2 domain mutations (e.g., R151_G152insVL) disrupt ion conductance, validating its role in channel gating .

  • Transcript Variants: Alternative splicing generates non-functional isoforms subject to nonsense-mediated decay .

  • Therapeutic Targets: TRIC-B restoration via gene therapy improves collagen secretion in OI patient-derived cells .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly include it in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery details.
Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
tmem38b-b; Trimeric intracellular cation channel type B-B; TRIC-B-B; TRICB-B; Transmembrane protein 38B-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem38b-b
Target Protein Sequence
MESLSEVSVQFSQLSMFPFFDMAHYLASVMSAREQAGALDIASHSPMASWFSAMLHCFGG GILSSILLAEPPVGILANTTNIMLASAIWYMVYYFPYDLFYNCFFFLPIRLIAAGMKEVT RTWKILSGITHAHSHYKDAWLVMITIGWARGAGGGLISNFEQLVRGVWKPESNEFLKMSY PVKVTLIGAVLFTLQHGHYLPISRHNLMFIYTMFLVSIKVTMMLTHSAGSPFLPLETPLH RILFGLRQNQAEVRESPSSSGAKGKPSKKTLDKDSGEQSNKKDK
Uniprot No.

Target Background

Function
This monovalent cation channel is essential for maintaining rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.
Database Links

KEGG: xla:444435

UniGene: Xl.84632

Protein Families
TMEM38 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is TMEM38B-B and what is its basic function in Xenopus laevis?

TMEM38B-B is a transmembrane protein that functions as a trimeric intracellular cation channel in Xenopus laevis. This protein plays a critical role in regulating intracellular calcium homeostasis by forming a channel that facilitates calcium entry into cells . The full-length protein consists of 284 amino acids and is also known by alternative names including TRIC-B-B or TRICB-B as indicated in the UniProt database (Q6GN30) . The protein contains multiple hydrophobic regions that span the cellular membrane, creating the pore structure necessary for cation transport. The channel specifically mediates calcium movements across intracellular membranes, which is essential for proper cellular signaling and development .

Research approaches to study this protein typically include gene knockdown experiments, overexpression studies, and most recently, CRISPR-Cas9 gene editing in Xenopus embryos to evaluate developmental phenotypes associated with altered channel function.

How does TMEM38B-B in Xenopus laevis compare to its ortholog in Xenopus tropicalis?

The comparison between TMEM38B-B in Xenopus laevis and Xenopus tropicalis reflects significant genomic differences between these related amphibian species:

FeatureXenopus laevisXenopus tropicalis
Genome typeAllotetraploidDiploid
Gene copiesTypically has duplicated copiesSingle copy
Evolutionary historyResult of hybridization ~50 million years agoMaintained diploid genome
Expression patternMay show subfunctionalization between paralogsSingle gene expression pattern

In Xenopus laevis, the allotetraploid genome resulted from hybridization of two species, leading to gene duplications throughout the genome . Consequently, TMEM38B-B likely exists as duplicated copies that may have undergone subfunctionalization or neofunctionalization compared to the single copy in Xenopus tropicalis. Researchers comparing these orthologs typically employ comparative sequence analysis to identify conserved functional domains and expression studies to determine if spatial or temporal expression patterns differ between species .

The high degree of synteny between frog and human genomes makes these comparative studies particularly valuable for understanding human gene organization and function, despite approximately 360 million years of evolutionary separation .

What are the optimal methods for expression and purification of recombinant TMEM38B-B?

The recombinant Xenopus laevis TMEM38B-B protein is most commonly expressed using E. coli expression systems for research applications . A systematic protocol involves:

  • Cloning preparation:

    • PCR amplification of the full-length coding sequence (amino acids 1-284)

    • Insertion into an expression vector with a histidine tag for purification

    • Verification by sequencing to confirm correct insertion and reading frame

  • Expression optimization:

    • Transformation into specialized E. coli strains (e.g., BL21(DE3) or Rosetta)

    • Small-scale expression tests to optimize temperature, induction time, and IPTG concentration

    • Scale-up to larger cultures for protein production

  • Purification process:

    • Cell lysis under conditions that preserve protein integrity

    • Solubilization of membrane fractions using appropriate detergents

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography for further purification and buffer exchange

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Circular dichroism to assess secondary structure

    • Functional assays to verify channel activity

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for long-term preservation . Because TMEM38B-B is a membrane protein, special attention must be paid to maintaining its native conformation through careful selection of detergents and buffer conditions throughout the purification process.

What are the key experimental considerations when studying calcium signaling pathways involving TMEM38B-B?

When investigating calcium signaling pathways involving TMEM38B-B in Xenopus models, researchers should consider several critical experimental factors:

  • Experimental system selection:

    • Whole embryos provide comprehensive developmental context

    • Animal cap explants allow tissue-specific studies

    • Oocyte expression systems enable electrophysiological characterization

    • Cell-free Xenopus egg extracts permit biochemical analysis in a cytoplasmic environment

  • Calcium imaging techniques:

    • Selection of appropriate calcium indicators based on sensitivity requirements

    • Optimization of imaging parameters for temporal and spatial resolution

    • Calibration procedures for quantitative measurements

    • Controls for autofluorescence and photobleaching

  • Genetic manipulation approaches:

    • Morpholino-mediated knockdown with validation controls

    • CRISPR-Cas9 gene editing for precise genomic modifications

    • mRNA injection for overexpression or rescue experiments

    • Dominant-negative constructs targeting specific protein domains

  • Interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Proximity labeling methods to capture transient interactions

    • FRET-based approaches to study protein-protein interactions in live cells

  • Functional readouts:

    • Calcium oscillation patterns in developing embryos

    • Electrophysiological measurements of channel activity

    • Developmental phenotypes associated with calcium signaling defects

    • Gene expression changes downstream of calcium-dependent pathways

Proper experimental design must include appropriate controls for each technique and consideration of the allotetraploid nature of the Xenopus laevis genome, which may require targeting multiple gene copies for complete functional analysis .

How can TMEM38B-B be utilized in studies of osteogenesis imperfecta?

Given the established association between TMEM38B mutations and osteogenesis imperfecta (OI) in humans , Xenopus TMEM38B-B provides a valuable model system for studying this disorder through several sophisticated approaches:

  • Disease modeling strategies:

    • Generation of equivalent mutations in Xenopus TMEM38B-B corresponding to human OI-causing variants

    • CRISPR-Cas9 gene editing to create precise genomic modifications

    • Expression of mutant forms in Xenopus embryos to assess developmental consequences

  • Phenotypic characterization:

    • Skeletal staining techniques to visualize bone formation defects

    • Micro-CT analysis to quantify bone density and architecture in tadpoles

    • Histological examination of ossification centers during development

    • Biomechanical testing to assess bone fragility phenotypes

  • Molecular pathway analysis:

    • Investigation of calcium homeostasis in osteoblast precursors

    • Assessment of collagen synthesis, secretion, and modification

    • Analysis of endoplasmic reticulum stress responses

    • Examination of crosstalk between calcium signaling and bone morphogenetic protein pathways

  • Therapeutic screening applications:

    • High-throughput screening of compounds that might rescue calcium signaling defects

    • Testing of potential therapeutics targeting downstream pathways

    • Assessment of gene therapy approaches using wild-type TMEM38B-B

The large number of embryos available from Xenopus, combined with their external development and amenability to genetic manipulation, makes this an excellent system for initial characterization of disease mechanisms and therapeutic approaches for TMEM38B-associated osteogenesis imperfecta .

What challenges exist in characterizing protein interactions with TMEM38B-B?

Characterizing the interaction partners of TMEM38B-B presents several methodological challenges that researchers must address:

  • Membrane protein-specific challenges:

    • Maintaining native conformation during solubilization

    • Preserving weak or transient interactions during purification

    • Distinguishing specific interactions from non-specific hydrophobic associations

    • Limited accessibility of certain domains for interaction studies

  • Technical approach limitations:

    • Traditional yeast two-hybrid systems may not be optimal for membrane proteins

    • Co-immunoprecipitation requires specific antibodies or epitope tags

    • Mass spectrometry sample preparation can disrupt membrane protein complexes

    • Detergent selection critically impacts which interactions are preserved

  • Xenopus-specific considerations:

    • Limited availability of validated antibodies for Xenopus proteins

    • Potential redundancy due to gene duplication in X. laevis

    • Developmental stage-specific interactions may complicate analysis

    • Distinguishing between direct and indirect interactions in complex tissues

  • Validation requirements:

    • Need for reciprocal pull-down experiments

    • Confirmation through multiple complementary techniques

    • Functional validation of identified interactions

    • Controls for non-specific binding to affinity matrices

To overcome these challenges, researchers increasingly employ proximity labeling approaches (BioID, APEX), membrane-specific yeast two-hybrid systems, and quantitative interaction proteomics with stringent statistical analysis. The Xenopus ORFeome project provides valuable resources for comprehensive interaction screening with properly folded native proteins .

What methodologies are most effective for structure-function studies of TMEM38B-B?

To elucidate the relationship between structure and function in TMEM38B-B, researchers can employ several complementary methodologies:

  • Mutagenesis approaches:

    • Alanine-scanning mutagenesis of predicted functional domains

    • Creation of chimeric constructs with related channels

    • Targeted modification of potential calcium-binding residues

    • Generation of truncation variants to identify essential domains

  • Electrophysiological characterization:

    • Two-electrode voltage clamp in Xenopus oocytes expressing channel variants

    • Patch-clamp recordings to assess single-channel properties

    • Measurement of ion selectivity using different ionic conditions

    • Pharmacological profiling with known channel modulators

  • Imaging techniques:

    • Fluorescently tagged constructs to monitor subcellular localization

    • FRET sensors to detect conformational changes

    • Calcium imaging to assess functional consequences of mutations

    • Super-resolution microscopy to visualize channel clustering

  • Biochemical analysis:

    • Limited proteolysis to identify stable structural domains

    • Cross-linking combined with mass spectrometry

    • Co-expression of separate domains to test assembly requirements

    • Assessment of oligomerization state through native gels or analytical ultracentrifugation

  • Computational approaches:

    • Homology modeling based on related ion channel structures

    • Molecular dynamics simulations to predict channel gating

    • Evolutionary analysis to identify conserved functional motifs

    • In silico prediction of disease-causing mutations

Integration of these approaches allows researchers to develop comprehensive models of how specific domains contribute to channel assembly, trafficking, gating, ion selectivity, and regulation in physiological and pathological contexts.

What evolutionary insights can be gained from studying TMEM38B-B across different species?

Evolutionary analysis of TMEM38B-B across species provides valuable insights into calcium channel evolution and adaptation:

  • Genomic synteny analysis:

    • The extraordinary conservation of synteny between frog and human genomes provides a framework for evolutionary studies

    • Around the centromere of human chromosome 1, gene order in approximately 150 Mb remains intact in X. tropicalis, despite 360 million years of evolutionary separation

    • This genomic stability suggests functional constraints on the organization of genes involved in calcium regulation

  • Sequence conservation patterns:

    • Highly conserved regions likely represent functionally critical domains

    • Variable regions may indicate species-specific adaptations

    • Analysis of selective pressure (dN/dS ratios) across protein domains reveals evolutionary constraints

    • Comparison of duplicated genes in X. laevis with single copies in X. tropicalis reveals post-duplication divergence patterns

  • Functional adaptation assessment:

    • Channel properties may differ between species from different environmental niches

    • Temperature sensitivity may vary in species adapted to different thermal environments

    • Expression patterns may show species-specific optimization for developmental timing

  • Disease-relevant insights:

    • Evolutionary conservation can predict the impact of human TMEM38B mutations

    • Residues conserved across all vertebrates are likely essential for basic channel function

    • Species-specific variations may reveal adaptive modifications to calcium regulation

    • Conservation patterns can inform classification of human genetic variants

The combination of experimental approaches with computational phylogenetic analysis allows researchers to reconstruct the evolutionary history of this important calcium channel and understand how fundamental calcium regulation mechanisms have been conserved or adapted across vertebrate lineages .

How does the allotetraploid genome of Xenopus laevis impact TMEM38B-B research compared to diploid models?

The allotetraploid nature of the Xenopus laevis genome creates both challenges and opportunities for TMEM38B-B research:

  • Gene redundancy considerations:

    • Duplicated genes may have overlapping or redundant functions

    • Complete loss-of-function may require targeting multiple copies

    • Subfunctionalization between duplicates may have occurred, with division of ancestral functions

    • Neofunctionalization may have resulted in new roles for one copy

  • Experimental design implications:

    • Morpholino or CRISPR targeting strategies must account for sequence differences between homeologs

    • Primers for RT-PCR must be designed to distinguish between duplicated genes

    • Antibodies may not distinguish between closely related proteins

    • Potential compensation by paralogous genes must be considered when interpreting phenotypes

  • Comparative advantages:

    • Comparison between X. laevis (allotetraploid) and X. tropicalis (diploid) provides insights into gene duplication effects

    • Natural subfunctionalization in X. laevis can reveal specialized roles of different protein domains

    • Comparison of expression patterns between duplicated genes can identify regulatory evolution

  • Practical considerations:

    • X. laevis embryos are larger, providing more material for biochemical studies

    • X. laevis oocytes are widely used for heterologous expression due to their size

    • X. tropicalis offers advantages for genetic studies due to shorter generation time and simpler genome

    • Genome sequence availability for both species facilitates comparative approaches

FeatureXenopus laevisXenopus tropicalisImplication for Research
Genome size~3.1 Gb~1.7 GbMore complex genomic analysis in X. laevis
Chromosome number3620Simpler genetic mapping in X. tropicalis
Generation time1-2 years4-6 monthsFaster genetic studies in X. tropicalis
Embryo size1-1.2 mm0.7-0.8 mmMore material for biochemistry in X. laevis

The publication of genome sequences for both species has greatly facilitated comparative approaches, allowing researchers to leverage the strengths of each model system while accounting for their genomic differences .

How can CRISPR-Cas9 technology advance functional studies of TMEM38B-B?

CRISPR-Cas9 technology offers transformative approaches for studying TMEM38B-B function in Xenopus models:

  • Precision gene editing strategies:

    • Generation of complete knockouts to assess loss-of-function phenotypes

    • Introduction of point mutations corresponding to human disease variants

    • Creation of reporter knock-ins to monitor endogenous expression patterns

    • Development of conditional knockout strategies using inducible systems

  • Technical implementation considerations:

    • Design of guide RNAs targeting conserved exons

    • For X. laevis, potentially targeting both homeologous copies

    • Optimization of delivery methods for maximum editing efficiency

    • Verification of edits through sequencing and functional assays

  • Phenotypic analysis approaches:

    • Assessment of calcium signaling defects using fluorescent indicators

    • Examination of developmental consequences in calcium-dependent processes

    • Investigation of bone formation defects related to osteogenesis imperfecta phenotypes

    • Transcriptomic analysis to identify downstream effects

  • Advanced applications:

    • Multiplex editing to simultaneously target multiple calcium channel components

    • Base editing for precise nucleotide substitutions without double-strand breaks

    • CRISPRi/CRISPRa for reversible modulation of gene expression

    • Creation of tissue-specific mutations using spatial/temporal Cas9 expression

  • Validation strategies:

    • Rescue experiments with wild-type mRNA to confirm specificity

    • Comparison of multiple independent lines to control for off-target effects

    • Complementary approaches (morpholinos, dominant negatives) to confirm phenotypes

    • Detailed off-target analysis through whole-genome sequencing

The optimization of CRISPR methods specifically for Xenopus, combined with the system's advantages for developmental studies, creates powerful new opportunities for understanding TMEM38B-B function in normal development and disease contexts .

What are the emerging approaches for studying TMEM38B-B in cellular calcium homeostasis?

Cutting-edge approaches for investigating TMEM38B-B's role in calcium homeostasis include:

  • Advanced imaging technologies:

    • Genetically encoded calcium indicators targeted to specific subcellular compartments

    • Light-sheet microscopy for high-speed, low-phototoxicity calcium imaging in developing embryos

    • Super-resolution microscopy to visualize channel distribution and clustering

    • Correlative light and electron microscopy to link function with ultrastructure

  • Optogenetic and chemogenetic tools:

    • Light-controlled calcium channel modulators

    • Optogenetic control of TMEM38B-B expression or activity

    • Chemical-genetic approaches for rapid and reversible inhibition

    • Photocaged calcium compounds for localized calcium release

  • Single-cell approaches:

    • Single-cell transcriptomics to identify cell type-specific expression patterns

    • Patch-seq to correlate electrophysiological properties with gene expression

    • Single-cell proteomics to quantify TMEM38B-B levels in rare cell populations

    • Cell type-specific CRISPR targeting to evaluate tissue-specific functions

  • Systems biology integration:

    • Mathematical modeling of calcium dynamics incorporating TMEM38B-B properties

    • Network analysis of calcium-dependent signaling pathways

    • Multi-omics integration to understand system-wide effects of channel dysfunction

    • Comparative systems analysis across evolutionary diverse species

  • Translational applications:

    • Development of small molecule modulators of channel activity

    • Gene therapy approaches for TMEM38B-associated disorders

    • High-throughput screening platforms using Xenopus embryos or oocytes

    • Patient-derived mutations for personalized medicine approaches

These emerging technologies, combined with the established strengths of the Xenopus system, provide unprecedented opportunities to understand how TMEM38B-B contributes to calcium homeostasis in health and disease, with potential implications for treating human conditions like osteogenesis imperfecta .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.