Recombinant Xenopus laevis Type I iodothyronine deiodinase (dio1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Type I Iodothyronine Deiodinase (DIO1)

Recombinant Xenopus laevis Type I iodothyronine deiodinase (DIO1) is an enzyme that plays a role in thyroid hormone metabolism in the frog Xenopus laevis . Specifically, it is involved in the deiodination of thyroid hormones, which is essential for regulating their activity .

Background on Iodothyronine Deiodinases

Iodothyronine deiodinases (DIOs) are a family of enzymes that catalyze the removal of iodine atoms from thyroid hormones . This process is critical for the activation and inactivation of thyroid hormones, thereby influencing their availability and signaling in target tissues . In vertebrates, including amphibians like Xenopus laevis, DIOs are essential for development and metamorphosis .

Types of Iodothyronine Deiodinases

There are three main types of iodothyronine deiodinases: DIO1, DIO2, and DIO3 . Each enzyme has a different tissue distribution, substrate preference, and catalytic properties .

  • DIO1: Can catalyze both outer-ring deiodination (ORD) and inner-ring deiodination (IRD) of thyroid hormones .

  • DIO2: Primarily involved in the activation of thyroxine (T4) to triiodothyronine (T3) through ORD .

  • DIO3: Primarily involved in the inactivation of T4 and T3 through IRD .

Characteristics of Xenopus laevis DIO1

The Xenopus laevis DIO1 enzyme shares high sequence homology with other vertebrate DIO1 enzymes . The Xenopus laevis D1 cDNA clone obtained from brain tissue has a complete sequence of 1.1 kb, encoding an open reading frame (ORF) of 252 amino acid residues . The catalytic center includes a UGA-encoded selenocysteine residue, and the 3' untranslated region contains a selenocysteine insertion sequence element .

Enzymatic Activity

Recombinant Xenopus laevis DIO1 exhibits both outer-ring deiodinase (ORD) and inner-ring deiodinase (IRD) activity . It can convert T4 to T3 (ORD) and reverse T3 (rT3) and can also convert T4 to reverse T3 (rT3) through inner-ring deiodination . The Michaelis constant (K$$_{m}$$) values for these reactions are in the micromolar range .

Role in Metamorphosis

Thyroid hormones are essential for amphibian metamorphosis . DIOs play a crucial role in regulating the local concentrations of T3 in different tissues during this process . Studies suggest that DIO1 in Xenopus laevis might have a different role compared to DIO2 and DIO3 during tadpole metamorphosis .

Impact of DIO1 Inhibition

Inhibition of DIOs can disrupt thyroid hormone signaling, leading to developmental abnormalities . For example, exposure of Xenopus laevis larvae to iopanoic acid (IOP), a DIO inhibitor, can cause thyroid-related biochemical changes and delayed metamorphosis .

Mutant Studies

Studies involving mutant enzymes have provided insights into the structure-function relationship of Xenopus laevis DIO1 . For instance, mutating a proline residue to serine (Pro132Ser) in the catalytic center of Xenopus laevis DIO1 increases its ORD activity and sensitivity to 6-PTU .

Relevance to Endocrine Disruption

Xenopus laevis is a valuable model organism for studying endocrine disruption . The thyroid hormone signaling pathway in Xenopus laevis embryos is susceptible to disruption by environmental chemicals .

In vitro studies

EnzymeIC50 (Iopanoic Acid)
Human DIO197 μM
Human DIO2231 μM
Human DIO3No inhibition
X. laevis DIO3No inhibition

Iopanoic acid (IOP) inhibits human DIO1 and DIO2, but does not inhibit human or X. laevis DIO3 under the assay conditions .

UniProt Information

UniProtKB provides detailed information about the Xenopus laevis DIO1 enzyme, including its amino acid sequence, function, and other relevant data . DIO1 is responsible for the deiodination of T4 into T3, and of T3 into T2 .

Adverse Outcome Pathway (AOP)

The adverse outcome pathway (AOP) describes how the inhibition of type I iodothyronine deiodinase (DIO1) during amphibian metamorphosis can lead to adverse outcomes . This AOP helps in understanding the mechanistic links between DIO1 inhibition and developmental effects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your application.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. To ensure your desired tag, please specify this requirement at the time of ordering, and we will prioritize its incorporation.
Synonyms
dio1; Type I iodothyronine deiodinase; 5DI; DIOI; Type 1 DI; Type-I 5'-deiodinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
dio1
Target Protein Sequence
MESLLQTIKLMLRYIQKALILFFLFLYVVVGKVLMFLFPQTMASVLKSRFEISGVHDPKF QYEDWGPTFFTYKFLRSVLEIMWMRLEDEAFVGHSAPNTPVVDLSGELHHIWDYLQGTRP LVLSFGSCTUPPFLFRLGEFNKLVNEFNSIADFLIIYIDEAHAADEWALKNNLHIKKHRS LQDRLAAAKRLMEESPSCPVVLDTMSNLCSAKYAALPERLYILQEGKIIYKGKMGPWGYK PEEVCSVLEKKK
Uniprot No.

Target Background

Function

This recombinant Xenopus laevis Type I iodothyronine deiodinase (DIO1) catalyzes the deiodination of thyroxine (T4; 3,5,3',5'-tetraiodothyronine) to triiodothyronine (T3; 3,5,3'-triiodothyronine), and T3 to 3,3'-diiodothyronine (T2).

Database Links

KEGG: xla:733447

UniGene: Xl.17649

Protein Families
Iodothyronine deiodinase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of Xenopus laevis DIO1 and how does it compare to other vertebrate species?

Xenopus laevis DIO1 is characterized by a 1.1 kb cDNA clone (including poly A tail) that encodes an open reading frame (ORF) of 252 amino acid residues with high homology to other vertebrate D1 enzymes. The core catalytic center includes a UGA-encoded selenocysteine residue, and the 3' untranslated region (approximately 300 nucleotides) contains a selenocysteine insertion sequence element . This structure reflects the conserved nature of deiodinases across vertebrate species, though with notable differences in enzyme sensitivity to inhibitors when compared to mammalian counterparts.

The sequence homology between Xenopus and other vertebrate DIO1 enzymes indicates evolutionary conservation of this important selenoenzyme, suggesting fundamental roles in thyroid hormone metabolism across species.

What are the primary enzymatic characteristics of recombinant Xenopus laevis DIO1?

Recombinant Xenopus laevis DIO1 exhibits several distinctive enzymatic properties:

  • Outer-ring deiodinase (ORD) activity with T4 (Km 0.5 μM) and reverse T3 (rT3) (Km 0.5 μM)

  • Inner-ring deiodinase activity with T4 (Km 0.4 μM)

  • Essentially insensitive to inhibition by 6-propyl-2-thiouracil (6-PTU) (IC50 > 1 mM)

  • Sensitive to gold thioglucose (IC50 0.1 μM) and iodoacetate (IC50 10 μM)

These biochemical parameters highlight the unique properties of Xenopus DIO1 compared to mammalian DIO1 enzymes, particularly its resistance to PTU inhibition while maintaining sensitivity to other inhibitors.

What is the tissue expression pattern of DIO1 in Xenopus laevis?

Native DIO1 activity in Xenopus laevis is relatively low across tissues, but specific expression patterns have been documented. Significant DIO1 mRNA expression is observed in juvenile brain tissue and adult liver and kidney . This distribution differs from the expression patterns of DIO2 and DIO3, which show more pronounced developmental regulation during metamorphosis.

The limited activity detection despite mRNA expression suggests potential post-transcriptional regulation or the requirement for specific activation conditions for the enzyme, highlighting the complex regulation of deiodinase activity in amphibian systems.

How does Xenopus laevis DIO1 differ from other deiodinase isoforms (DIO2 and DIO3) in function?

The three deiodinase isoforms serve distinct physiological roles:

DeiodinasePrimary FunctionMetamorphic RelevanceBiochemical Activity
DIO1Both inner and outer ring deiodinationAppears to lack relevance during amphibian metamorphosisCatalyzes conversion of T4 to T3 and inactivation of thyroid hormones
DIO2Outer ring deiodinationCritical for tissue-specific activation of thyroid hormones during metamorphosisConverts T4 to active T3
DIO3Inner ring deiodinationImportant for inactivation of thyroid hormones in specific tissues during metamorphosisInactivates T4 and/or T3 by converting to rT3 and/or T2

What are the methodological approaches for expressing and characterizing recombinant Xenopus laevis DIO1?

Recombinant expression and characterization of Xenopus DIO1 involves several methodological steps:

  • cDNA cloning and expression vector construction:

    • Isolation of DIO1 cDNA from brain tissue

    • Insertion into appropriate expression vectors (e.g., PCDNA3)

  • Heterologous expression:

    • Transfection of cells with expression vector containing the full-length cDNA

    • Validation of expression through Western blot analysis

  • Enzymatic activity assessment:

    • Preparation of cell homogenates

    • Measurement of outer-ring and inner-ring deiodination activities

    • Determination of kinetic parameters (Km, Vmax) using varying substrate concentrations

    • Inhibition studies with compounds like 6-PTU, gold thioglucose, and iodoacetate

  • Mutational analysis:

    • Site-directed mutagenesis (e.g., Pro132Ser mutation)

    • Comparative characterization of wild-type and mutant enzymes

These approaches allow for comprehensive functional characterization of the enzyme and identification of key structural determinants of its activity.

How does the Pro132Ser mutation affect the enzymatic properties of Xenopus laevis DIO1?

The Pro132Ser mutation in Xenopus DIO1 produces dramatic changes in enzymatic properties:

ParameterWild-type DIO1Pro132Ser Mutant
ORD activity with T4Km 0.5 μMKm ~4 μM
ORD activity with rT3Km 0.5 μMKm ~4 μM
6-PTU sensitivityIC50 > 1 mM (resistant)IC50 2 μM (highly sensitive)

This mutation demonstrates that a single amino acid substitution at position 132, which is 2 positions downstream from the catalytic selenocysteine, can fundamentally alter substrate binding and inhibitor sensitivity . This finding highlights the critical importance of this residue in determining the pharmacological profile of deiodinases and explains species differences in deiodinase inhibitor sensitivity.

What techniques can be used to investigate the role of DIO1 in development and metamorphosis of Xenopus laevis?

Several experimental approaches can elucidate the role of DIO1 in Xenopus development:

  • Temporal gene expression analysis:

    • Real-time PCR to quantify dio1 mRNA expression at different developmental stages

    • In situ hybridization to localize expression in specific tissues

  • Pharmacological inhibition studies:

    • Exposure of developing tadpoles to specific DIO inhibitors like iopanoic acid (IOP)

    • Assessment of biochemical (thyroid hormone levels) and morphological (developmental rate) endpoints

  • Gene knockdown/knockout approaches:

    • Morpholino oligonucleotides for temporary gene knockdown

    • CRISPR-Cas9 for permanent genetic modifications

    • Analysis of resulting phenotypes and thyroid hormone profiles

  • Integrative analysis:

    • Correlation of biochemical changes with apical outcomes (e.g., growth, metamorphic rate)

    • Development of adverse outcome pathways (AOPs) to link molecular initiating events to adverse outcomes

These approaches can help distinguish the role of DIO1 from other deiodinases during amphibian development and metamorphosis.

How can the insensitivity of Xenopus DIO1 to 6-PTU be leveraged in experimental designs?

The natural resistance of Xenopus DIO1 to 6-PTU (IC50 > 1 mM) provides unique experimental opportunities:

  • Selective inhibition studies:

    • Using 6-PTU to selectively inhibit DIO1 in other species while maintaining Xenopus DIO1 activity

    • Creating differential inhibition profiles across deiodinase isoforms in comparative studies

  • Structure-function relationship investigations:

    • Using the Xenopus DIO1 as a reference to identify critical residues determining inhibitor sensitivity

    • Engineering inhibitor-resistant variants of deiodinases for biotechnological applications

  • Phylogenetic research:

    • Exploring evolutionary divergence of deiodinase sensitivity across species

    • Investigating adaptive significance of inhibitor resistance in specific environments

  • Inhibitor development:

    • Using structural insights from Xenopus DIO1 to design novel, selective deiodinase inhibitors

    • Testing hypotheses about inhibitor binding mechanisms

This unique property of Xenopus DIO1 serves as a valuable tool for delineating the specific contributions of different deiodinase isoforms to physiological processes.

What are the challenges in translating in vitro findings about DIO1 to in vivo understanding of thyroid hormone metabolism?

Several challenges exist in bridging in vitro DIO1 characterization to in vivo thyroid physiology:

  • Tissue-specific microenvironments:

    • In vitro assay conditions may not recapitulate tissue-specific cofactors and regulators

    • The selenoprotein nature of DIO1 requires specific cellular machinery for proper folding and function

  • Compensatory mechanisms:

    • Potential redundancy between deiodinase isoforms in vivo

    • Activation of alternative metabolic pathways when one enzyme is inhibited or absent

  • Spatiotemporal considerations:

    • Dynamic changes in expression and activity during development

    • Difficulty in capturing tissue-specific, stage-dependent enzyme activities

  • Extrapolation across species:

    • Species differences in sensitivity to inhibitors (e.g., 6-PTU resistance in Xenopus)

    • Variations in relative importance of different deiodinase isoforms across vertebrates

Addressing these challenges requires integrative approaches combining in vitro biochemical characterization with in vivo functional studies and computational modeling to develop comprehensive understanding of deiodinase roles in thyroid hormone homeostasis.

What are the critical factors in designing assays for Xenopus laevis DIO1 activity?

Robust DIO1 activity assays must consider several critical factors:

  • Substrate selection and concentration:

    • T4, rT3, or other iodothyronines as substrates

    • Concentration ranges appropriate for the Km values (around 0.4-0.5 μM for Xenopus DIO1)

  • Detection methods:

    • Radiometric assays using labeled iodothyronines

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for higher specificity

    • Consideration of interference from inhibitors when using certain detection methods

  • Cofactor requirements:

    • Dithiothreitol (DTT) or other thiol cofactors

    • Optimization of cofactor concentrations

  • Assay conditions:

    • pH optimization (typically physiological pH 7.0-7.4)

    • Temperature considerations (amphibian vs. mammalian physiological temperatures)

    • Incubation times that allow for linear reaction kinetics

  • Controls:

    • Positive controls (known deiodinase preparations)

    • Inhibitor controls (gold thioglucose for Xenopus DIO1)

Careful attention to these factors ensures reliable and reproducible activity measurements for comparative studies across experimental conditions.

How can genetic polymorphisms in DIO1 be investigated and what implications do they have for research?

Investigation of DIO1 genetic polymorphisms involves multiple approaches:

  • Identification methods:

    • PCR amplification and sequencing of DIO1 gene regions

    • Restriction fragment length polymorphism (RFLP) analysis for known SNPs

    • Next-generation sequencing for comprehensive polymorphism detection

  • Functional assessment:

    • In vitro expression of variant forms

    • Enzyme kinetics comparisons

    • Protein stability and expression level analysis

  • Population studies:

    • Frequency analysis of specific polymorphisms across populations

    • Association with phenotypic variations

Known DIO1 polymorphisms in humans include rs2235544 and rs11206244, which affect T3, T4, and rT3 concentrations . In Xenopus, polymorphism studies are less developed but could reveal important insights into natural variation in deiodinase function.

Research implications include:

  • Interpretation of interindividual variability in experimental outcomes

  • Development of models for personalized medicine approaches

  • Understanding evolutionary adaptation of thyroid hormone metabolism

What approaches can detect and quantify native DIO1 expression in Xenopus laevis tissues?

Several complementary techniques can be used for DIO1 detection and quantification:

  • mRNA expression analysis:

    • Quantitative real-time PCR (qRT-PCR) for relative expression levels

    • RNA sequencing for comprehensive transcriptomic profiling

    • In situ hybridization for spatial localization within tissues

  • Protein detection:

    • Western blotting using specific antibodies

    • Immunohistochemistry for tissue localization

    • Flow cytometry with fluorescently tagged antibodies for quantitative assessment

  • Activity assays:

    • Tissue homogenate enzymatic assays

    • Microsomal fraction activity measurements

    • Monitoring of iodide release or product formation

Each method provides different types of information. For instance, mRNA quantification by qRT-PCR may not directly correlate with protein levels or enzymatic activity due to post-transcriptional and post-translational regulation mechanisms. Using multiple approaches provides more comprehensive understanding of DIO1 expression patterns.

How can Xenopus laevis DIO1 be used as a model to understand the role of deiodinases in endocrine disruption?

Xenopus laevis DIO1 provides valuable insights into endocrine disruption mechanisms:

  • Screening platform development:

    • In vitro assays using recombinant Xenopus DIO1 to identify potential deiodinase-disrupting chemicals

    • Comparison with DIO2 and DIO3 assays to develop isoform-specific profiles

  • Mechanistic studies:

    • Structure-activity relationships for inhibitor binding

    • Investigation of reversible versus irreversible inhibition mechanisms

    • Understanding of interference with selenocysteine incorporation

  • Adverse Outcome Pathway (AOP) development:

    • Linking molecular initiating events (deiodinase inhibition) to adverse outcomes

    • Characterization of key events in the pathway from enzyme inhibition to developmental effects

  • Regulatory toxicology applications:

    • Development of screening approaches for thyroid-disrupting chemicals

    • Integration into comprehensive testing strategies like the Amphibian Metamorphosis Assay (AMA)

The unique properties of Xenopus DIO1, such as its resistance to 6-PTU, can help distinguish between different mechanisms of thyroid disruption and provide more precise characterization of environmental contaminants.

What insights from Xenopus laevis DIO1 research can be applied to human health and disease?

Cross-species applications of Xenopus DIO1 research include:

  • Structural insights for drug development:

    • Understanding the basis for inhibitor sensitivity/resistance

    • Development of selective deiodinase inhibitors for therapeutic applications

  • Disease modeling:

    • Characterization of polymorphism effects on enzyme function

    • Insights into pathophysiology of thyroid disorders

  • Cancer research:

    • Investigation of DIO1's potential tumor suppressive role observed in other contexts

    • Understanding mechanisms of altered thyroid hormone metabolism in malignancies

  • Evolutionary medicine:

    • Comparative analysis of deiodinase function across species

    • Insights into fundamental mechanisms conserved from amphibians to humans

Recent studies have shown that DIO1 may have tumor suppressive properties in certain cancers, with lower DIO1 levels correlating with worse survival and therapy resistance . The structural and functional characterization of Xenopus DIO1 can provide insights into similar mechanisms potentially relevant to human disease.

How might emerging technologies advance the study of Xenopus laevis DIO1?

Several cutting-edge technologies offer new avenues for DIO1 research:

  • CRISPR-Cas9 genome editing:

    • Generation of DIO1 knockout Xenopus models

    • Precise introduction of specific mutations (e.g., Pro132Ser) to study effects in vivo

    • Creation of reporter systems for monitoring DIO1 expression

  • Organoid and ex vivo systems:

    • Development of Xenopus organ cultures maintaining native deiodinase expression

    • Multi-tissue systems to study integrated thyroid hormone metabolism

  • Advanced imaging techniques:

    • Live cell imaging of DIO1 trafficking and localization

    • Real-time monitoring of enzymatic activity in living systems

  • Systems biology approaches:

    • Integration of transcriptomic, proteomic, and metabolomic data

    • Computational modeling of thyroid hormone regulatory networks

    • Machine learning for prediction of deiodinase-disrupting compounds

  • Single-cell analysis techniques:

    • Characterization of cell-specific DIO1 expression patterns

    • Understanding of heterogeneous responses to thyroid hormones and inhibitors

These technologies promise to provide deeper understanding of DIO1 biology beyond traditional biochemical and molecular approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.