Recombinant Xenopus laevis Uncharacterized protein C17orf62 homolog is a protein that belongs to the Cytochrome b-245 chaperone 1 homolog (CYBC1) family . The protein, with UniProt ID Q5HZS2, is expressed in E. coli as a full-length protein of 188 amino acids with a His-Tag attached to the N-terminal . Synonyms for the protein include CYBC1, EROS, Cytochrome b-245 chaperone 1 homolog, and Essential for reactive oxygen species protein .
| Gene Name | Xenopus laevis Uncharacterized protein C17orf62 homolog |
|---|---|
| Synonyms | cybc1; eros; Cytochrome b-245 chaperone 1 homolog; Essential for reactive oxygen species protein; Eros |
| UniProt ID | Q5HZS2 |
| Sequence Length | 1-188 aa |
| AA Sequence | MYMQVESRTGTLLHLKRNPSIRSWSLLVGILSVGLAAAYYSTDTWLWKLFYVAGCAFVALQNLEDWEEAVFDKKSGKAILTTYSIYKKLLTLCKGGQDQVVVLLKEIRDVNVAEERVRYFGKGYVIVLRFVTGISHPLTQSAVLGARSDVEAVAKELTKFLELDLVRTRSQAVEESSDSE SDGALDKQ |
This recombinant protein is produced in E. coli and is available from commercial sources for research purposes . The protein is provided as a lyophilized powder with a purity level of greater than 90%, as determined by SDS-PAGE .
The Xenopus laevis uncharacterized protein C17orf62 homolog is related to CYBC1, a protein that is essential for reactive oxygen species production . CYBC1 deficiency in humans results in chronic granulomatous disease with colitis and a distinct profile of infections, which indicates the importance of macrophage function .
Recombinant Xenopus laevis Uncharacterized protein C17orf62 homolog can be employed in various research applications, including:
Quantitative Proteomics of Xenopus laevis Embryos:* This study used iTRAQ isotopic labeling and mass spectrometry to examine the expression kinetics of nearly 4,000 proteins of Xenopus laevis during early development, from fertilized egg to neurula embryo .
Identification of Unusual Peptides in Sea Anemone Venom: Research has focused on identifying novel, biologically active molecules in sea anemones, with a focus on polypeptide compounds .
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
This protein functions as a chaperone, essential for the stable expression of the CYBA and CYBB subunits within the cytochrome b-245 heterodimer.
KEGG: xla:496319
UniGene: Xl.33031
Xenopus laevis Uncharacterized protein C17orf62 homolog is a protein that has been identified in the African clawed frog (Xenopus laevis), but whose specific functions remain largely unknown. The recombinant form is typically produced as a His-tagged full-length protein (188 amino acids) expressed in E. coli systems . As its name suggests, it is a homolog to the human C17orf62 protein, which is encoded by an open reading frame on chromosome 17. The evolutionary conservation of this protein between amphibians and mammals suggests it may play important biological roles that have been maintained through vertebrate evolution.
Xenopus laevis offers several distinct advantages as a model organism for studying proteins, including the C17orf62 homolog. These advantages include:
Evolutionary proximity to higher vertebrates in terms of physiology, gene expression, and organ development, making findings potentially more translatable to mammalian systems .
Versatility across multiple biological disciplines including developmental biology, toxicology, neurobiology, endocrinology, immunology, and tumor biology .
Practical research advantages including the ability to maintain laboratory colonies easily, induce spawning year-round, obtain embryos via in vitro fertilization, and access to all developmental stages from embryo to adult .
Genomic resources including a sequenced genome with similarity to mammals, enabling the use of high-throughput technologies like RNA-Seq and quantitative proteomics .
Availability of genetic modification techniques including morpholino oligonucleotides and CRISPR/Cas9 genome editing systems that can be applied to studying protein function .
Researchers can obtain the recombinant Xenopus laevis Uncharacterized protein C17orf62 homolog for laboratory use through specialized scientific supply companies that produce recombinant proteins. The protein is typically available as a His-tagged full-length construct expressed in E. coli expression systems . The recombinant protein contains the complete amino acid sequence (1-188) of the native protein with an additional histidine tag to facilitate purification and downstream applications .
When selecting a recombinant protein source, researchers should consider:
Expression system (typically E. coli for this protein)
Purification method used
Tag type and position (N-terminal or C-terminal His-tag)
Protein length (full-length vs. truncated versions)
Purity and endotoxin levels
Storage conditions and shelf life
Characterizing the function of an uncharacterized protein like the Xenopus laevis C17orf62 homolog requires a multifaceted approach:
Sequence analysis and structural prediction: Perform bioinformatic analysis to identify conserved domains, motifs, and structural features through comparison with characterized proteins. This includes alignment with the human ortholog and orthologs from other species to identify evolutionarily conserved regions.
Expression pattern analysis: Determine the temporal and spatial expression patterns of the protein during development and in adult tissues using techniques like in situ hybridization and immunohistochemistry.
Loss-of-function studies: Apply CRISPR/Cas9 genome editing or morpholino oligonucleotide technology, which has been well-established in Xenopus laevis , to knock out or knock down the protein and observe phenotypic effects.
Protein-protein interaction studies: Identify binding partners through techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling methods to place the protein within cellular pathways and complexes.
Subcellular localization: Determine where the protein resides within cells using fluorescent protein fusions or immunofluorescence microscopy.
Functional rescue experiments: Test if the human ortholog can rescue phenotypes in Xenopus models, which would provide insight into functional conservation across species.
Developmental stage-specific analysis: Leverage the advantage of Xenopus as a developmental model to study the protein's role across different stages from embryogenesis through metamorphosis and into adulthood .
Understanding protein-protein interactions is crucial for elucidating the functional role of uncharacterized proteins like the C17orf62 homolog. While specific interaction partners for this protein are not fully characterized in the available literature , researchers can employ several approaches to investigate these interactions:
Affinity purification-mass spectrometry (AP-MS): Using the His-tagged recombinant protein as bait to capture interacting proteins from Xenopus cell or tissue lysates, followed by mass spectrometry identification.
Proximity-dependent biotin identification (BioID): Fusing the protein to a biotin ligase to label nearby proteins in living cells, providing insight into the protein's "neighborhood."
Cross-linking mass spectrometry: Employing chemical crosslinkers to stabilize transient protein interactions before identification by mass spectrometry.
Comparative interactomics: Comparing interaction partners between Xenopus and human orthologs to identify conserved functional complexes.
Contextual interaction mapping: Investigating how protein interactions change during different developmental stages or upon cellular stresses, which is particularly relevant given Xenopus laevis' utility in developmental studies .
Once interaction partners are identified, researchers can construct protein interaction networks to propose functional hypotheses and design targeted validation experiments.
Applying CRISPR/Cas9 genome editing to study the C17orf62 homolog in Xenopus laevis presents several unique challenges:
Genome complexity: Xenopus laevis is allotetraploid with a duplicated genome, meaning there may be multiple gene copies that need to be targeted simultaneously to achieve complete knockout .
Homeolog redundancy: The presence of homeologous genes (duplicated genes from the two subgenomes) may provide functional redundancy, requiring knockout of all copies to observe phenotypes.
Guide RNA design: Designing specific gRNAs that target all copies while avoiding off-target effects requires careful computational analysis.
Mosaicism: F0 CRISPR-edited animals often show mosaicism, requiring breeding to establish stable lines, which takes longer in Xenopus compared to other model organisms like zebrafish.
Phenotype assessment: Given the potential developmental roles of this protein, phenotypes may span multiple stages from embryo to adult, requiring comprehensive analysis across the life cycle.
Validation challenges: Confirming successful editing may require next-generation sequencing approaches due to the duplicated genome.
Despite these challenges, CRISPR/Cas9 technology has been successfully applied in Xenopus laevis, and researchers can take advantage of established protocols and resources from centers like the National Xenopus Resource (NXR) and the European Xenopus Resource Centre (EXRC) .
The methodology used for expression and purification of the recombinant Xenopus laevis C17orf62 homolog significantly impacts its functionality in experimental applications:
Expression systems: While E. coli is commonly used for expressing this protein , it lacks the machinery for certain post-translational modifications. Researchers should consider whether potential glycosylation, phosphorylation, or other modifications are essential for function when selecting an expression system.
Protein folding: Proper folding is critical for function. Expression conditions (temperature, induction time, media composition) should be optimized to maximize properly folded protein yield.
Purification strategy: The His-tag enables purification via immobilized metal affinity chromatography (IMAC) , but additional purification steps may be necessary to achieve high purity. Consider size exclusion chromatography to ensure monomeric protein and remove aggregates.
Tag position and removal: The presence and position (N- or C-terminal) of the His-tag may affect protein function. If concerns exist, researchers should assess whether tag removal via protease cleavage improves activity.
Buffer optimization: Storage buffer composition (pH, salt concentration, reducing agents) should be optimized to maintain stability and function. Activity assays should be performed to confirm functionality after purification.
Endotoxin removal: For cell-based assays, endotoxin removal is essential to prevent confounding inflammatory responses.
Quality control: Batches should be validated for purity, homogeneity, and activity before use in critical experiments.
Comparative approaches between Xenopus laevis and other model organisms can provide valuable insights into the function of the C17orf62 homolog:
Cross-species functional complementation: Testing whether C17orf62 homologs from different species (human, mouse, zebrafish) can rescue phenotypes in Xenopus knockouts or vice versa can reveal functional conservation or specialization.
Evolutionary analysis: Comparing protein sequences, expression patterns, and developmental roles across species can identify conserved functional domains and evolutionarily constrained regions.
Multi-omics comparison: Integrating transcriptomic, proteomic, and metabolomic data from multiple species following perturbation of C17orf62 homologs can reveal conserved pathways and species-specific differences.
Developmental timing comparison: Analyzing expression across developmental stages in Xenopus compared to zebrafish or mouse can identify critical periods for protein function, taking advantage of the accessible developmental stages in Xenopus .
Tissue-specific function comparison: Examining tissue distribution and function across species can reveal specialized roles that may have evolved differently.
Regulatory network comparison: Analyzing transcription factor binding sites and gene regulatory networks across species can elucidate conserved and divergent control mechanisms.
These comparative approaches benefit from the established advantages of Xenopus laevis as a model organism, including its developmental accessibility and genomic resources , while leveraging insights from other model systems.
Xenopus laevis offers unique embryological advantages for studying the developmental roles of proteins like the C17orf62 homolog:
Microinjection techniques: Researchers can inject mRNA, protein, morpholinos, or CRISPR components into specific blastomeres at early cleavage stages to target particular tissues or organs, allowing for spatially controlled loss- or gain-of-function studies .
Explant cultures: Isolated tissue explants can be cultured ex vivo to study protein function in specific developmental contexts without the complexity of the whole embryo.
Fate mapping: By combining protein manipulation with lineage tracers, researchers can track the consequences of altered protein function on specific cell lineages throughout development.
Hormone-induced metamorphosis: The ability to control metamorphosis timing using thyroid hormone treatment provides a unique opportunity to study protein function during this dramatic developmental transition .
In situ hybridization and immunohistochemistry: These techniques allow for precise localization of the protein and its mRNA throughout development.
Transgenic approaches: The ability to generate transgenic Xenopus embryos with fluorescent reporters under the control of the C17orf62 homolog promoter can provide real-time visualization of expression patterns .
Transplantation experiments: Cell or tissue transplantation between manipulated and wild-type embryos can help distinguish cell-autonomous versus non-cell-autonomous functions.
High-throughput phenotyping: The large number of synchronously developing embryos facilitates high-throughput screening approaches to identify subtle phenotypes associated with protein manipulation.
These techniques leverage the key advantages of Xenopus laevis as a developmental model, including the accessibility of all developmental stages and the ability to produce large numbers of embryos year-round .
Understanding the Xenopus laevis C17orf62 homolog could potentially contribute to human disease research in several ways:
Evolutionary conservation: If the protein function is conserved between Xenopus and humans, insights from the amphibian model could directly inform human biology. The evolutionary proximity of Xenopus to higher vertebrates in terms of physiology and gene expression supports this translational potential .
Developmental disorders: If the C17orf62 homolog plays crucial roles in embryonic development, studying its function in Xenopus could illuminate mechanisms underlying human developmental disorders, particularly given the accessibility of all developmental stages in this model organism .
Comparative genomics approach: Identifying conserved protein interaction networks and signaling pathways between species could reveal previously unknown roles of C17orf62 in human disease processes.
Functional screening platform: The Xenopus system could serve as a platform for screening potential therapeutic compounds that target the C17orf62 pathway, leveraging the advantages of the FETAX (Frog Embryo Teratogenesis Assay—Xenopus) test system .
Gene editing validation: Before attempting therapeutic gene editing in human systems, the Xenopus model could provide valuable validation of CRISPR/Cas9 approaches targeting C17orf62 .
Protein domain function: Structure-function analysis in Xenopus could identify critical protein domains that might be affected by human mutations, potentially linking uncharacterized variants in human C17orf62 to disease phenotypes.
To investigate the potential role of the C17orf62 homolog in cellular signaling pathways, researchers should consider the following experimental designs:
Phosphoproteomic analysis: Compare the phosphoproteome of wild-type versus C17orf62 knockout/knockdown Xenopus embryos or cells to identify affected signaling pathways. This approach can reveal both direct and indirect effects on cellular phosphorylation networks.
Protein domain mapping: Generate truncated or site-mutated versions of the recombinant protein to identify domains critical for its function or interaction with signaling components.
Pathway perturbation studies: Systematically inhibit or activate major signaling pathways (e.g., MAPK, Wnt, Notch, BMP/TGF-β) in conjunction with C17orf62 manipulation to identify genetic and functional interactions.
Real-time signaling reporters: Employ fluorescent or luminescent reporters for various signaling pathways in Xenopus embryos with altered C17orf62 function to monitor pathway activity dynamically.
Subcellular redistribution assays: Track the movement of fluorescently tagged signaling components in response to stimuli in the presence or absence of functional C17orf62.
Transcriptional profiling: Perform RNA-seq on tissues or embryos with manipulated C17orf62 expression to identify transcriptional changes in known signaling pathway target genes.
Biochemical enzyme assays: Test whether the recombinant protein exhibits enzymatic activities like kinase, phosphatase, or ubiquitin ligase activity that could directly impact signaling cascades.
Interactome analysis under pathway stimulation: Identify dynamic changes in protein-protein interactions following pathway activation in the presence or absence of C17orf62.
These approaches take advantage of the established experimental systems in Xenopus laevis while applying modern molecular and biochemical techniques to dissect signaling pathway involvement .
Resolving contradictory data when studying uncharacterized proteins like the C17orf62 homolog across different experimental systems requires a systematic approach:
Standardize experimental conditions: Ensure that protein preparation methods, expression systems, and experimental conditions are consistent to eliminate technical variables that might cause contradictory results .
Cross-validate with multiple techniques: When contradictions arise, employ orthogonal methods to verify findings. For example, if protein-protein interactions show discrepancies between yeast two-hybrid and co-immunoprecipitation, add a third method like proximity ligation assay.
Consider developmental context: Results may differ due to developmental stage-specific effects, particularly in Xenopus where the protein's role may change throughout development from embryo to adult .
Account for species-specific differences: When comparing results between Xenopus and other model organisms, consider evolutionary divergence in protein function and regulation.
Evaluate tissue specificity: Contradictory findings may result from tissue-specific roles of the protein, requiring careful comparison of the exact tissues examined across studies.
Analyze isoform differences: Check whether multiple protein isoforms exist that might have different functions, which could explain seemingly contradictory results.
Meta-analysis approach: When sufficient data exists, perform a systematic review and meta-analysis of all available evidence to identify consistent patterns amid contradictory details.
Collaborate and replicate: Establish collaborations between labs reporting contradictory results to directly compare protocols and replicate experiments under identical conditions.
Consider gene duplication effects: In Xenopus laevis specifically, the allotetraploid genome means there may be multiple homologs with partially redundant or divergent functions , potentially explaining contradictory results compared to diploid systems.
The most promising future research directions for understanding the Xenopus laevis C17orf62 homolog include:
Comprehensive functional genomics: Employing genome-wide CRISPR screens in Xenopus to identify genetic interactions with C17orf62, taking advantage of the established genome editing techniques in this model system .
Structural biology approaches: Determining the three-dimensional structure of the protein through X-ray crystallography or cryo-electron microscopy to inform function and potential ligand interactions.
Single-cell analysis: Utilizing single-cell RNA-seq and proteomics to understand cell type-specific functions and expression patterns across development.
In vivo imaging: Developing techniques for live imaging of tagged C17orf62 in developing Xenopus embryos to track dynamic changes in localization and interactions.
Comparative evolutionary analysis: Expanding comparative studies across additional species to understand the evolutionary history and functional conservation of the protein.
Environmental response studies: Investigating how the protein's expression and function change in response to environmental stressors, leveraging Xenopus as an ecotoxicological model .
Integration with multi-omics data: Combining transcriptomic, proteomic, metabolomic, and epigenomic data to place C17orf62 within broader biological networks.
Translational research: Exploring potential connections between findings in Xenopus and human disease genetics, particularly for conditions potentially linked to the human ortholog.
These directions build upon the established advantages of Xenopus laevis as a model organism while embracing cutting-edge technologies to unravel the functions of this uncharacterized protein.
To effectively integrate findings about the C17orf62 homolog from Xenopus laevis into a broader understanding of vertebrate protein evolution, researchers should:
Perform comprehensive phylogenetic analysis: Construct detailed phylogenetic trees of C17orf62 homologs across vertebrate species to understand evolutionary relationships and identify potential functional divergence points.
Compare syntenic relationships: Analyze the genomic context around C17orf62 across species to identify conserved gene neighborhoods that might suggest functional relationships.
Identify selection signatures: Calculate selection pressures on different protein domains across species to identify regions under purifying selection (functionally constrained) versus those under positive selection (potentially adapting to new functions).
Compare expression patterns: Systematically compare tissue-specific and developmental expression patterns across model organisms to identify conserved and divergent regulation.
Conduct cross-species rescue experiments: Test functional complementation by expressing C17orf62 homologs from different species in Xenopus knockouts to assess functional conservation.
Map protein interaction evolution: Compare protein interaction networks around C17orf62 homologs across species to understand how molecular partnerships have evolved.
Analyze post-translational modification conservation: Compare post-translational modification sites across species to identify conserved regulatory mechanisms.
Consider genome duplication effects: Account for the unique genomic history of Xenopus laevis as an allotetraploid organism when comparing to diploid vertebrates .
Develop ancestral sequence reconstruction: Computationally predict ancestral protein sequences to understand the evolutionary trajectory of C17orf62.
Create accessible comparative databases: Contribute findings to publicly accessible databases to facilitate broader comparative analyses across research groups.
This integrative approach leverages the evolutionary position of Xenopus laevis among vertebrates to gain insights into protein evolution that extend beyond any single model system .
Based on available information about recombinant protein production in Xenopus systems, the following protocol recommendations can be made for the C17orf62 homolog:
Expression System Selection:
E. coli expression: The full-length protein (188 amino acids) with a His-tag has been successfully expressed in E. coli systems . BL21(DE3) or Rosetta strains are recommended for potentially improved expression of eukaryotic proteins.
Expression Protocol:
Transform expression plasmid into appropriate E. coli strain
Culture in rich media (e.g., TB or 2XYT) until OD600 reaches 0.6-0.8
Induce with IPTG at reduced temperature (16-20°C) overnight to improve proper folding
Harvest cells by centrifugation and flash-freeze pellet or proceed directly to lysis
Purification Protocol:
Resuspend bacterial pellet in lysis buffer (typically 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTT, protease inhibitors)
Lyse cells using sonication or pressure-based methods
Clear lysate by high-speed centrifugation (20,000 × g, 30 min, 4°C)
Apply supernatant to Ni-NTA resin equilibrated with lysis buffer
Wash extensively with wash buffer (lysis buffer with 20-30 mM imidazole)
Elute protein with elution buffer (lysis buffer with 250-300 mM imidazole)
Perform buffer exchange via dialysis or size exclusion chromatography into storage buffer (typically 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT, 10% glycerol)
Quality Control:
Verify protein purity by SDS-PAGE (>90% purity recommended)
Confirm protein identity by Western blot and/or mass spectrometry
Assess protein folding by circular dichroism or thermal shift assay
Test functionality in appropriate assays based on predicted function
Storage Recommendations:
Store at -80°C in single-use aliquots to avoid freeze-thaw cycles
Include cryoprotectants such as 10% glycerol in storage buffer
Monitor stability over time with appropriate quality control tests
This protocol is based on general principles for recombinant protein production and may need optimization for the specific characteristics of the C17orf62 homolog.
For predicting the function of uncharacterized proteins like the Xenopus laevis C17orf62 homolog, researchers should employ a comprehensive bioinformatic approach:
Sequence-based function prediction:
PSI-BLAST and HHpred for detecting remote homologs
InterProScan for identifying conserved domains and motifs
SMART and Pfam for domain architecture analysis
Signal peptide and transmembrane prediction tools (SignalP, TMHMM)
Analysis of conserved residues across species alignments
Structural prediction and analysis:
AlphaFold2 or RoseTTAFold for protein structure prediction
Structure-based function prediction using tools like COFACTOR or COACH
Protein-protein docking simulations to predict potential interaction partners
Active site prediction for potential enzymatic functions
Systems biology approaches:
Co-expression network analysis using Xenopus transcriptomic datasets
Phylogenetic profiling to identify functionally related proteins
Gene neighborhood analysis for prokaryotic homologs (if they exist)
Integrated analysis of protein-protein interaction data
Specialized predictive tools:
Subcellular localization prediction (DeepLoc, LocTree3)
Post-translational modification sites prediction
Intrinsically disordered region prediction
Functional site prediction (e.g., nucleic acid binding, metal binding)
Comparative genomics:
Analysis of conservation patterns across vertebrates
Identification of co-evolving residues using methods like MISTIC
Synteny analysis to identify conserved genomic neighborhoods
Machine learning approaches:
Application of deep learning models trained on protein function data
Feature extraction from multiple data sources for improved prediction accuracy
Integration of wet-lab data:
Incorporation of any available proteomics or phenotypic data
Analysis of mutant phenotypes in other organisms for orthologous genes
These approaches should be used in combination, as each method has its strengths and limitations. Results from multiple methods can be integrated to generate consensus predictions with higher confidence.