Recombinant Xenopus laevis UPF0197 transmembrane protein C11orf10 homolog

Shipped with Ice Packs
In Stock
Cat. No.
BT2038207
Source
in vitro E.coli expression system
Synonyms
tmem258; Transmembrane protein 258; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258; Oligosaccharyl transferase subunit TMEM258
Quick Inquiry

Description

Gene and Functional Context

The protein corresponds to the tmem258 gene (UniProt ID: Q6GP81), a homolog of human TMEM258. Key annotations include:

Gene AttributeDetails
Gene Nametmem258
SynonymsC11orf10, Kuduk, Oligosaccharyl transferase subunit TMEM258
FunctionSubunit of the oligosaccharyltransferase (OST) complex, critical for N-glycosylation of proteins in the ER .
Associated PathwaysER homeostasis, protein glycosylation, and cellular stress responses .

Research Applications

This recombinant protein is primarily used in:

  • Structural Studies: Analysis of transmembrane domain architecture and glycosylation mechanisms .

  • Functional Assays: Investigating ER-associated processes, including protein folding and quality control .

  • Biochemical Studies: Purification and interaction analyses using affinity tags (e.g., His tag) .

Quality Control and Validation

  • Purity Verification: SDS-PAGE and mass spectrometry confirm >90% homogeneity .

  • Sequence Validation: Matches the predicted molecular weight (~9 kDa) and full-length sequence .

  • Functional Activity: Demonstrated binding to glycosylation substrates in preliminary assays (unpublished data cited by vendors) .

Cross-Species Relevance

While derived from Xenopus laevis, this protein shares 85% sequence identity with human TMEM258, making it a model for studying conserved ER functions . Its role in glycosylation aligns with findings in human cell lines, where TMEM258 mutations are linked to ER stress disorders .

Future Research Directions

  • Mechanistic Studies: Elucidate its role in OST complex assembly using cryo-EM .

  • Disease Modeling: Investigate TMEM258-linked pathologies, such as spinocerebellar ataxia .

  • Proteomic Profiling: Integrate with Xenopus egg extract systems for large-scale interaction mapping .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem258; Transmembrane protein 258; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258; Oligosaccharyl transferase subunit TMEM258
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-79
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem258
Target Protein Sequence
MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV
Uniprot No.
Q6GP81

Target Background

Function
This protein is a subunit of the oligosaccharyl transferase (OST) complex. It catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This represents the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally, and the complex associates with the Sec61 complex at the channel-forming translocon complex, which facilitates protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity.
Database Links

KEGG: xla:444157

UniGene: Xl.3590

Protein Families
TMEM258 family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.