Recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A

What is Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A?

Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A is a protein belonging to the TMEM263 family. It is the amphibian homolog of the human C12orf23 (chromosome 12 open reading frame 23), also known as TMEM263 (transmembrane protein 263). This protein consists of 114 amino acids with the following sequence: MSQTEKIEEPVPSYLCEEPPEGTVKDHPQQQPGMISRVTGGIFSMTKGAVGATIGGVAWIGGKSFEVTKTAVTSVPSIGVGIVKGSVSAVTGSVAAVGSAVSSKVSGKKKDKSD . The protein is characterized as a transmembrane protein, suggesting it spans cellular membranes and potentially plays a role in cellular signaling, transport, or structural maintenance.

Why is Xenopus laevis commonly used as a model organism in research?

Xenopus laevis (African Clawed Frog) has become a cornerstone model organism in biological research for several scientifically advantageous reasons. Female X. laevis are prolific egg layers, producing large, robust embryos that develop externally and are transparent, making them ideal for observing developmental processes in real-time . This transparency allows researchers to track cellular migration, differentiation, and morphogenesis without invasive procedures. Additionally, X. laevis has historical significance as the first vertebrate successfully cloned in laboratory conditions, establishing it as a pioneer model for genetic manipulation studies . The species is remarkably resilient and adaptable to laboratory conditions, tolerating a wide range of pH values while maintaining consistent developmental patterns, making experimental standardization more achievable across research facilities . These characteristics collectively establish Xenopus laevis as an invaluable model for developmental biology, cell signaling, and protein function studies.

How does recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A differ from native protein?

The recombinant form of Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A differs from its native counterpart primarily through the addition of an N-terminal His-tag and its production method in E. coli expression systems . This heterologous expression produces a protein that maintains the complete amino acid sequence (1-114) of the native protein but includes the His-tag affinity purification feature . While the core structure and theoretical function remain intact, several considerations distinguish the recombinant from native protein:

• The addition of the His-tag potentially alters surface charge distribution and may influence protein-protein interactions in experimental settings.

• Expression in bacterial systems means the protein lacks post-translational modifications that might occur in amphibian cells.

• The recombinant protein is provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE, making it more concentrated and standardized than native forms .

• Storage requirements (-20°C/-80°C) and reconstitution protocols are specifically designed for the recombinant protein's stability rather than mirroring native conditions .

These differences must be accounted for when designing experiments and interpreting results, especially in studies examining protein-protein interactions or functional assays.

What functional domains and structural characteristics define Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A?

Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A contains several structural elements that contribute to its predicted function as a transmembrane protein. Based on sequence analysis and comparative genomics with other TMEM263 family members, the protein likely contains:

• A hydrophobic core region (amino acids approximately 30-50) rich in glycine, alanine, isoleucine, and valine, forming a transmembrane helix with the sequence segment "GVGATIGGVAWIGGK" .

• Charged residues at both N- and C-termini that likely reside in cytoplasmic or extracellular domains, with the C-terminal lysine-rich region "KKKDKSD" potentially serving as a membrane anchoring or protein interaction site .

• A conserved serine/threonine-rich region (SVSAVTGSVAAVGSAVSSKVS) that may serve as phosphorylation sites for regulatory kinases, suggesting post-translational modification as a potential regulatory mechanism .

While the precise tertiary structure has not been fully elucidated through crystallography or NMR studies, these features align with the protein's classification in the UPF0444 protein family, characterized by proteins with undefined functions but conserved structural elements. The protein's relatively small size (114 amino acids) suggests it may function as part of a larger protein complex rather than as an independent functional unit.

What experimental approaches are most effective for studying membrane localization of Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A?

Investigating the membrane localization of Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A requires specialized techniques that preserve membrane integrity while enabling visualization. Based on current research methodologies, the following experimental approaches are recommended:

• Immunofluorescence microscopy with subcellular fractionation: This dual approach combines visual localization with biochemical confirmation. The recombinant His-tagged protein can be detected using anti-His antibodies or generated protein-specific antibodies . Counterstaining with organelle markers (e.g., DAPI for nucleus, MitoTracker for mitochondria) allows precise determination of subcellular localization.

• Electron microscopy with immunogold labeling: For ultra-structural localization, immunogold labeling of the protein followed by transmission electron microscopy provides nanometer-scale resolution of membrane integration patterns. This technique is particularly valuable for determining the protein's orientation within the membrane.

• FRET-based interaction analysis: When studying potential interaction partners, Förster Resonance Energy Transfer (FRET) methodologies using fluorescently tagged TMEM263 and candidate interacting proteins can reveal not only localization but also dynamic associations in live cells.

• Density gradient centrifugation: For biochemical confirmation of membrane association, sucrose or Percoll density gradients can separate cellular components based on density, allowing subsequent Western blot analysis of fractions using anti-His antibodies to detect the recombinant protein .

• Cell surface biotinylation: To specifically determine if the protein reaches the plasma membrane, cell surface proteins can be selectively biotinylated, isolated with streptavidin beads, and analyzed by Western blot for the presence of TMEM263.

For optimal results, expression systems should mimic native conditions as closely as possible. While Xenopus oocytes represent an ideal expression system for amphibian proteins, mammalian cell lines (such as HEK293T cells) have also proven effective for studying transmembrane protein localization .

What are the optimal storage and handling conditions for recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A?

The stability and activity of recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A is highly dependent on proper storage and handling protocols. Based on manufacturer recommendations and protein biochemistry principles, the following guidelines should be implemented:

• Long-term storage: Store the lyophilized powder at -80°C for maximum stability. After reconstitution, the protein solution should be aliquoted and stored at -20°C/-80°C to prevent degradation . Avoid repeated freeze-thaw cycles as they can significantly decrease protein activity through denaturation.

• Reconstitution protocol: Centrifuge the vial briefly before opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For enhanced stability, add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage) .

• Working solution handling: For experiments, working aliquots can be stored at 4°C for up to one week without significant loss of activity . When diluting stock solutions, use buffer systems that maintain pH stability, preferably matching experimental conditions.

• Quality control verification: Before utilizing in critical experiments, verify protein integrity via SDS-PAGE and/or Western blot using anti-His antibodies. This confirms both molecular weight accuracy and the presence of the His-tag for downstream applications.

• Transport considerations: When transporting between laboratories, maintain cold chain integrity using dry ice. Upon receiving, store immediately at -80°C and allow to equilibrate for at least 2 hours before opening to prevent condensation which can contribute to degradation .

These precautions ensure maximum protein stability and experimental reproducibility while working with this recombinant protein.

What expression systems are most suitable for producing recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A?

The choice of expression system significantly impacts the yield, folding, and functionality of recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A. Multiple expression platforms offer distinct advantages depending on research objectives:

• E. coli expression systems (currently used in commercial production ):

  • Advantages: High yield, cost-effective, rapid production timeline, well-established protocols

  • Limitations: Lacks eukaryotic post-translational modifications, potential improper folding of transmembrane domains

  • Optimization strategies: Use specialized E. coli strains (e.g., C41(DE3), C43(DE3)) designed for membrane protein expression; employ fusion tags that enhance solubility; optimize induction conditions (lower temperature, reduced IPTG concentration)

• Insect cell expression systems (Baculovirus):

  • Advantages: Eukaryotic processing capabilities, better folding of complex proteins, moderate yield

  • Limitations: Higher cost, longer production timeline, more complex methodology

  • Best applications: When protein activity depends on eukaryotic post-translational modifications

• Mammalian expression systems (HEK293T, CHO cells):

  • Advantages: Most authentic post-translational modifications, proper membrane protein folding and trafficking

  • Limitations: Lower yield, highest cost, complex maintenance

  • Best applications: Functional studies requiring native-like protein behavior, especially protein-protein interactions

• Cell-free expression systems:

  • Advantages: Rapid production, ability to incorporate modified amino acids, avoidance of toxicity issues

  • Limitations: Higher cost, potentially lower yield

  • Best applications: When rapid screening of protein variants is needed

How can researchers optimize experimental protocols for studying protein-protein interactions involving Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A?

Investigating protein-protein interactions (PPIs) involving transmembrane proteins presents unique challenges due to their hydrophobic nature and membrane integration. For Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A, the following optimized experimental approaches are recommended:

• Co-immunoprecipitation (Co-IP) with membrane solubilization optimization:

  • Optimize detergent selection: Test a panel of detergents (e.g., digitonin, DDM, CHAPS) at varying concentrations to solubilize membranes while preserving protein-protein interactions

  • Utilize the N-terminal His-tag for pull-down assays with Ni-NTA beads followed by Western blotting to detect interacting partners

  • Critical control: Perform parallel experiments with non-specific His-tagged proteins to identify false positives

• Proximity-based labeling techniques:

  • BioID or TurboID fusion constructs with TMEM263 allow biotinylation of proximal proteins within the native cellular environment

  • APEX2 fusion followed by proximity labeling can map the protein's interactome with temporal and spatial resolution

  • Data analysis should include rigorous statistical filtering to identify true interactors versus random proximity proteins

• Split-reporter complementation assays:

  • Bimolecular Fluorescence Complementation (BiFC) using fragments of fluorescent proteins fused to TMEM263 and candidate interactors

  • Split-luciferase assays provide quantitative measurement of interaction strength

  • Design control experiments with known non-interacting proteins to establish background signal thresholds

• Surface Plasmon Resonance (SPR) or Biolayer Interferometry (BLI) with reconstituted proteoliposomes:

  • Reconstitute purified recombinant TMEM263 into liposomes to maintain native membrane environment

  • Immobilize proteoliposomes on sensor chips/tips for real-time interaction kinetics

  • Calculate binding affinities (KD) for validated interactions

• Cross-species interaction conservation analysis:

  • Compare interaction profiles between Xenopus TMEM263 and mammalian orthologs to identify evolutionarily conserved binding partners

  • Prioritize interactions that are conserved across species for functional validation

When analyzing data, implement computational filtering to account for the high background often encountered in membrane protein interaction studies. Interactions should be confirmed through multiple independent techniques, and quantitative parameters (binding affinities, stoichiometry) should be determined whenever possible to distinguish primary from secondary interactions.

How can recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A be utilized in developmental biology research?

Recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A presents valuable opportunities for developmental biology investigations, particularly given the established role of Xenopus as a model organism for embryonic development. The following experimental applications leverage this protein for developmental research:

• Loss-of-function and gain-of-function studies:

  • Morpholino-mediated knockdown of endogenous TMEM263 in Xenopus embryos followed by phenotypic analysis

  • Microinjection of recombinant protein or mRNA for overexpression to assess developmental consequences

  • Based on chicken studies, particular attention should be paid to growth phenotypes, as TMEM263 mutations have been linked to dwarf phenotypes in other vertebrates

• Tissue-specific expression pattern analysis:

  • Immunohistochemistry using anti-TMEM263 antibodies across developmental stages to map temporal and spatial expression patterns

  • RNA in situ hybridization to correlate protein expression with transcript localization

  • RT-qPCR analysis comparing expression levels across developmental stages, similar to methodologies used in chicken studies

• Pathway interaction studies:

  • Investigation of potential interactions with growth hormone signaling pathways, given the connection to growth phenotypes in other species

  • Analysis of TMEM263 expression in response to various signaling modulators (e.g., IGF, BMP, Wnt pathways)

  • Correlation with expression patterns of known developmental regulators to establish pathway connections

• Comparative developmental biology:

  • Cross-species analysis comparing TMEM263 function between Xenopus, chicken, and mammalian models

  • Evolutionary conservation assessment of developmental roles through rescue experiments

  • Construction of phylogenetic expression maps to determine whether developmental functions are conserved

When designing these experiments, researchers should consider establishing stably transfected Xenopus cell lines expressing tagged versions of TMEM263 to facilitate consistent experimental conditions. Additionally, the relatively small size of TMEM263 (114 amino acids) makes it amenable to total chemical synthesis as an alternative to recombinant expression, potentially allowing for the incorporation of modified amino acids or fluorescent labels at precise positions.

What approaches should be used to investigate the function of Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A in cellular signaling?

Investigating the role of Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A in cellular signaling requires multi-faceted approaches that capture both static interactions and dynamic signaling events. Based on research methodologies from related transmembrane protein studies, the following experimental strategies are recommended:

• Signaling pathway perturbation analysis:

  • Systematic examination of major signaling pathways (MAPK, JAK/STAT, Wnt, etc.) in TMEM263-depleted versus overexpressing cells

  • Phosphoproteomic analysis to identify changes in global phosphorylation patterns following TMEM263 manipulation

  • Western blot analysis of key signaling molecules in cellular fractions, with particular focus on growth-related pathways suggested by the chicken dwarf phenotype association

• Real-time signaling dynamics visualization:

  • Generation of FRET-based biosensors incorporating TMEM263 to monitor conformational changes upon activation

  • Live-cell imaging with fluorescently tagged TMEM263 to track subcellular relocalization in response to stimuli

  • Calcium imaging in TMEM263-expressing cells to detect potential involvement in calcium signaling

• Interactome mapping with temporal resolution:

  • Time-course proximity labeling (BioID/TurboID) following cell stimulation to capture dynamic interaction changes

  • Pulsed SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with co-immunoprecipitation to quantify interaction kinetics

  • Construction of temporal protein-protein interaction networks to identify signaling cascade positioning

• Signaling pathway reconstruction:

  • Reconstitution of minimal signaling systems in liposomes containing purified TMEM263 to assess direct effects on pathway components

  • In vitro kinase assays to determine if TMEM263 serves as a substrate for specific kinases or affects kinase activity

  • Identification of post-translational modifications on TMEM263 using mass spectrometry under different cellular conditions

Given the connection to growth regulation in other species , particular attention should be paid to growth hormone/IGF signaling pathways, potentially using the RT-qPCR methodology for IGF1 described in chicken studies. When designing these experiments, controls must include parallel analyses with mutated versions of TMEM263 (especially in the transmembrane and C-terminal domains) to identify functionally important regions for signaling activity.

What are common challenges when working with recombinant transmembrane proteins like Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A?

Working with recombinant transmembrane proteins presents several technical challenges that require specific optimization strategies. For Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A, researchers commonly encounter the following issues and solutions:

• Protein aggregation and improper folding:

  • Challenge: Hydrophobic transmembrane domains often aggregate during expression and purification

  • Solutions:

    • Optimize detergent selection and concentration during purification (start with mild detergents like DDM or CHAPS)

    • Consider adding stabilizing agents like glycerol (5-50%) or specific lipids during reconstitution

    • Use lower expression temperatures (16-18°C) to slow protein production and improve folding

• Low expression yield:

  • Challenge: Transmembrane proteins often express poorly in heterologous systems

  • Solutions:

    • Test multiple expression systems (bacterial, insect, mammalian) to identify optimal production platform

    • Optimize codon usage for the expression host

    • Consider fusion tags that enhance expression (MBP, SUMO) in addition to the His-tag

    • Implement systematic optimization of induction conditions (temperature, inducer concentration, duration)

• Difficult solubilization while maintaining native conformation:

  • Challenge: Harsh detergents may efficiently solubilize but denature the protein

  • Solutions:

    • Perform detergent screening (96-well format) to identify optimal solubilization conditions

    • Consider amphipols or nanodiscs for stabilizing the protein in a more native-like environment

    • Implement stepwise solubilization protocols with increasing detergent concentrations

• Challenges in activity assays and functional characterization:

  • Challenge: Defining and measuring "activity" for proteins with unclear functions

  • Solutions:

    • Develop multiple complementary assay systems (binding, localization, impact on cellular processes)

    • Utilize chimeric proteins with known functional domains to assess membrane integration

    • Implement cellular phenotype screens after expression or knockdown of TMEM263

• Reconstitution into functional membrane environments:

  • Challenge: Artificial membranes may not recapitulate the native lipid environment

  • Solutions:

    • Test multiple lipid compositions for reconstitution experiments

    • Consider extracting native membranes from Xenopus tissues for more authentic reconstitution

    • Perform activity assays in multiple membrane mimetic systems to identify optimal conditions

When encountering these challenges, systematic documentation of conditions tested and outcomes observed is critical for identifying patterns that lead to successful handling of this transmembrane protein. Additionally, comparing protocols used for related proteins in the TMEM263 family across species can provide valuable insights into optimization strategies.

How should researchers design control experiments when studying Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A?

Robust experimental design for studying Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A requires carefully selected controls to distinguish specific effects from experimental artifacts. The following control strategies should be implemented across different experimental approaches:

• For protein expression and purification studies:

  • Negative control: Empty vector expression and purification using identical protocols

  • Positive control: Well-characterized His-tagged protein of similar size processed in parallel

  • Quality control: SDS-PAGE and Western blot analysis to confirm size and purity above 90%

  • Functional verification: Circular dichroism (CD) spectroscopy to confirm proper folding of purified protein

• For localization and trafficking experiments:

  • Subcellular marker controls: Co-staining with established organelle markers

  • Tag-only control: Expression of the His-tag alone to rule out tag-driven localization

  • Mutated controls: Versions with altered transmembrane domains to confirm sequence-specific localization

  • Cross-species comparison: Human TMEM263 expression to assess conservation of trafficking signals

• For functional and interaction studies:

  • Scrambled protein control: Recombinant protein with randomized sequence maintaining amino acid composition

  • Domain deletion controls: Systematic removal of protein domains to map interaction interfaces

  • Antibody controls: IgG isotype controls for immunoprecipitation experiments

  • Competition controls: Unlabeled protein competition assays to demonstrate binding specificity

• For genetic manipulation experiments:

  • Rescue controls: After knockdown, reintroduce wildtype or mutant protein to demonstrate specificity

  • Off-target controls: Use multiple knockdown approaches (CRISPR, morpholinos, RNAi) targeting different regions

  • Dosage controls: Establish dose-response relationships for both knockdown and overexpression

  • Temporal controls: Implement inducible systems to distinguish developmental from acute effects

• For reconstitution experiments:

  • Lipid-only controls: Liposomes without protein to establish baseline behavior

  • Heat-denatured protein controls: Confirm that observed effects require properly folded protein

  • Orientation controls: Assays to verify correct topology of the protein in artificial membranes

  • Alternative protein controls: Other transmembrane proteins of similar size but different function

What are the key considerations for researchers planning to work with Recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A?

Researchers embarking on studies involving Recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog A should consider several critical factors to ensure experimental success. This transmembrane protein presents unique challenges and opportunities that require careful experimental planning and execution.

First, proper handling and storage protocols are essential for maintaining protein integrity. The recombinant protein should be stored at -20°C/-80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles . Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol (5-50%) for long-term storage stability .

Second, researchers should carefully select expression systems based on their experimental objectives. While E. coli systems provide cost-effective protein production, mammalian or Xenopus cell-based systems may be necessary for studies requiring native post-translational modifications or authentic membrane integration. The current commercial recombinant protein is expressed in E. coli with N-terminal His-tag fusion , which may influence certain protein properties.

Third, the evolutionary context of TMEM263 should inform experimental design. The connection between TMEM263 variants and growth phenotypes in chicken suggests potential involvement in developmental or growth-related pathways in Xenopus as well. Cross-species comparative approaches may provide valuable insights into conserved functions.

Fourth, comprehensive control experiments are essential for distinguishing specific effects from experimental artifacts. These should include vector-only expressions, tag-only controls, and related proteins with similar physical properties but different sequences.

Finally, researchers should consider the multiple methodological approaches discussed throughout this FAQ when designing their experimental workflow. Often, combining complementary techniques (structural, biochemical, cellular, and genetic) provides the most robust insights into protein function.