Recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog B

Shipped with Ice Packs
In Stock

Description

Protein Identity and Classification

The UPF0444 transmembrane protein C12orf23 homolog B is a protein expressed in Xenopus laevis that belongs to the UPF0444 protein family. This protein is also known as transmembrane protein 263-B (tmem263-b) and is identified by the UniProt accession number Q5U4X2 . The "UPF" designation (Uncharacterized Protein Family) indicates that while the protein has been identified and sequenced, its precise biological function remains to be fully elucidated. The C12orf23 nomenclature suggests homology to a protein originally identified on human chromosome 12.

Molecular Weight and Physical Properties

Calculations based on the amino acid composition reveal that the protein has a molecular mass of approximately 13,489.71 Daltons. This molecular weight is consistent with the expected size of a small transmembrane protein. The detailed amino acid weight contribution can be represented in the following table:

Amino AcidCount in SequenceIndividual Weight (Da)Total Contribution (Da)
Alanine (A)Multiple89.09Partial sum
Cysteine (C)Multiple121.15Partial sum
Glycine (G)Multiple75.07Partial sum
Valine (V)Multiple117.15Partial sum
OthersVaryingVariousRemaining sum
Total114-13,489.71

The protein's molecular properties make it suitable for various biochemical and structural studies, with its relatively small size facilitating recombinant expression and purification.

Expression Systems

The Recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog B is typically produced in Escherichia coli expression systems . This bacterial expression system allows for efficient production of the protein in quantities suitable for research applications. The recombinant version commonly includes an N-terminal histidine tag (His-tag), which facilitates purification through affinity chromatography . The expression construct typically encompasses the full-length protein sequence (amino acids 1-114), providing a complete representation of the native protein structure.

Purification and Quality Control

Following expression in E. coli, the recombinant protein undergoes purification processes that typically yield preparations with greater than 90% purity as determined by SDS-PAGE analysis . The purified protein is commonly provided in lyophilized form, which enhances stability during shipping and storage. Quality control measures ensure that the final product maintains its structural integrity and biochemical properties for research applications.

Transmembrane Protein Classification

As a member of the transmembrane protein family, the UPF0444 C12orf23 homolog B is presumed to span cellular membranes. Transmembrane proteins play crucial roles in cellular processes including signal transduction, transport of molecules, and maintenance of cellular structure. While the specific membrane localization of this protein has not been explicitly described in the search results, its classification as a transmembrane protein suggests integration within cellular membranes of Xenopus laevis.

Evolutionary Conservation

The existence of both A and B homologs of this protein in Xenopus laevis (tmem263-a and tmem263-b) suggests potential gene duplication events . Furthermore, the identification of a human homolog, TMEM263 (transmembrane protein 263, gene ID 90488) , indicates evolutionary conservation across vertebrate species. This conservation suggests fundamental biological importance, as functionally significant proteins tend to be preserved across evolutionary distance.

Potential Functions

While the specific function of UPF0444 transmembrane protein C12orf23 homolog B remains largely uncharacterized, its conservation across species and classification as a transmembrane protein suggest potential roles in:

  1. Membrane organization and maintenance

  2. Transport of ions or small molecules

  3. Signal transduction or cellular communication

  4. Structural roles in specific cellular compartments

Research into related transmembrane proteins may provide insights into its function, though direct experimental evidence for this specific protein's role remains limited in the current literature.

Current Research Uses

The recombinant version of this protein serves several purposes in molecular and cellular research:

  1. As an antigen for antibody production against the native protein

  2. For protein-protein interaction studies to identify binding partners

  3. In structural biology investigations to determine three-dimensional conformation

  4. As a standard for quantitative analyses of protein expression in Xenopus laevis tissues

Potential Experimental Applications

The availability of purified recombinant UPF0444 transmembrane protein C12orf23 homolog B enables various experimental approaches that may elucidate its function:

Experimental ApproachPotential Insights
Co-immunoprecipitation studiesIdentification of interacting proteins
Cellular localization assaysDetermination of subcellular distribution
Functional knockdownPhenotypic effects of protein deficiency
Structural analysisThree-dimensional configuration and binding domains
Comparative studies with homolog AFunctional divergence between paralogs

These applications highlight the value of recombinant protein production for advancing our understanding of proteins with unknown functions.

Relationship to Homolog A

Xenopus laevis appears to express two related proteins in this family: UPF0444 transmembrane protein C12orf23 homolog A (tmem263-a) and homolog B (tmem263-b) . While the search results provide limited information on homolog A, the presence of two paralogs suggests potential functional specialization following gene duplication events. Comparative analysis of these homologs could reveal insights into their respective biological roles and evolutionary history.

Human TMEM263 Connection

The human homolog, TMEM263 (transmembrane protein 263), is identified in the NCBI gene database (gene ID 90488) . While specific functional data about this human protein is not detailed in the search results, the evolutionary relationship between the Xenopus and human proteins suggests potential functional conservation. Research on human TMEM263 might provide comparative insights that could illuminate the function of the Xenopus protein.

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
tmem263-b; Transmembrane protein 263-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem263-b
Target Protein Sequence
MSETEKIEEAAPPYLCEEPPEGAVKDHPQQQPGMISRVTGGIFSLTRGAVGATIGGVAWI GGKSFEVTKTAVTSVPSIGVGIVKGGVSVVTGSVAAVGSAVSNKVSGKKKDKSD
Uniprot No.

Target Background

Database Links

KEGG: xla:495413

UniGene: Xl.57039

Protein Families
TMEM263 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM263 and why study it in Xenopus laevis?

TMEM263 (formerly C12orf23) is a transmembrane protein with emerging evidence suggesting crucial roles in growth and bone development. While much remains to be characterized about this protein, studies in humans have demonstrated significant associations between TMEM263 and femoral neck bone mineral density (FN-BMD) . The protein appears to be correlated with osteoblast functional modules that impact bone mineral density by modulating bone-forming osteoblast activity .

Xenopus laevis serves as an excellent model organism for studying TMEM263 because:

  • Its phylogenetically intermediate position between aquatic vertebrates and land tetrapods provides evolutionary context for protein function conservation

  • The immune system and developmental biology of Xenopus is remarkably well-conserved yet allows researchers to distinguish species-specific adaptations from more fundamental conserved features

  • Xenopus embryos can be easily induced to breed in laboratory settings, making developmental studies highly accessible

  • The model allows for comprehensive analysis of protein expression changes during development, as demonstrated in large-scale proteomic studies that have successfully quantified nearly 4,000 proteins across developmental stages

How is TMEM263 thought to function at the molecular level?

Current evidence suggests TMEM263 may function through several molecular mechanisms:

  • Growth hormone pathway interaction: Protein-protein interaction studies have demonstrated that TMEM263 physically interacts with growth hormone 1 (GH1), suggesting it may act as a regulator in transport or signal transduction within growth pathways .

  • Ion channel regulation: TMEM263 has been identified as an interaction partner of potassium channel genes Slick and Slack, which are sodium-activated channels widely expressed in the central nervous system . This suggests potential roles in neuronal regulation or signaling.

  • Bone formation regulation: TMEM263 expression levels correlate with osteoblast functional modules that impact bone mineral density, indicating functional involvement in cartilage and bone formation processes .

The multifunctional nature of this protein makes it particularly valuable for developmental biology research using the Xenopus model system.

What experimental approaches are most effective for studying TMEM263 expression during Xenopus development?

The study of TMEM263 expression during Xenopus development is best approached through a combination of proteomic and molecular techniques:

  • Quantitative proteomics using iTRAQ labeling: Isobaric tags for relative and absolute quantitation (iTRAQ) methodology has been successfully employed to monitor protein expression kinetics of Xenopus laevis embryos at multiple developmental stages . This approach can detect and quantify thousands of proteins simultaneously, making it ideal for tracking TMEM263 expression within the broader proteomic context.

  • Stage-specific western blotting: For targeted validation of expression patterns identified through proteomics, western blotting across developmental stages can confirm protein-level changes, as demonstrated for other developmentally regulated proteins like XCdc6 .

  • mRNA expression analysis: Complementing protein studies with transcript analysis provides insight into post-transcriptional regulation. Previous studies have detected mRNA expression of approximately 5,000 genes in Xenopus laevis early development (stages 2-33) .

  • Single-cell analysis approaches: Advanced proteomic technologies now enable protein expression studies in single zygotes, allowing for precise temporal resolution of expression changes during the earliest developmental stages .

When designing these experiments, researchers should consider the natural protein abundance distribution in Xenopus embryos, as detection sensitivity is strongly influenced by relative protein abundance and mass spectrometer limitations .

How can the Xenopus oocyte system be leveraged for functional studies of recombinant TMEM263?

The Xenopus oocyte presents a powerful cellular model for studying TMEM263 function through several methodological approaches:

A limitation to consider is that variability in post-translational processing between oocytes can lead to functional differences in expressed proteins . Researchers should implement appropriate controls and sufficient biological replicates to account for this variability.

What methodological considerations are important when designing loss-of-function studies for TMEM263 in Xenopus?

When designing loss-of-function studies for TMEM263 in Xenopus, researchers should consider:

  • Technique selection based on experimental timeline:

    • Morpholino antisense oligonucleotides for transient knockdown during early development

    • CRISPR/Cas9 genome editing for stable genetic knockout studies

    • Dominant-negative construct expression for pathway interference

  • Validation strategies for knockdown/knockout efficiency:

    • Western blotting to confirm protein depletion

    • qRT-PCR to assess transcript reduction

    • Immunohistochemistry to evaluate spatial expression changes

  • Developmental timing considerations:

    • Stage-specific requirements for TMEM263 function

    • Maternal contribution of TMEM263 that may mask early phenotypes

    • Critical windows for phenotypic assessment

  • Phenotypic analysis framework:

    • Skeletal development metrics based on known association with bone mineral density

    • Growth parameter measurements given connection to growth hormone pathway

    • Neural development assessment due to interaction with ion channels

  • Rescue experiments to confirm specificity:

    • Co-injection of wild-type TMEM263 mRNA with knockdown reagents

    • Structure-function analysis through rescue with modified versions

Given TMEM263's potential roles in bone development and growth pathways, researchers should particularly focus on skeletal phenotypes and growth metrics when assessing loss-of-function effects.

What are the optimized parameters for detecting low-abundance TMEM263 in Xenopus proteomic studies?

Detecting low-abundance proteins like TMEM263 in Xenopus samples requires careful optimization of proteomic workflows. Based on computational modeling of experimental design for proteomics, several parameters significantly impact detection success:

  • Protein separation strategy:

    • Implementing effective protein separation prior to digestion increases success rate and relative dynamic range (RDR) for detecting low-abundance proteins

    • Multi-dimensional separation approaches are recommended when targeting proteins across wide abundance ranges

  • Mass spectrometry detection optimization:

    • Improving the MS detection limit has a substantial impact on success rate and RDR

    • For targeted detection of TMEM263, a mass spectrometer with detection sensitivity of better than 1 fmol is recommended

  • Sample loading considerations:

    • Increasing peptide material loaded (>0.1 μg) in the peptide separation step effectively improves detection of low-abundance proteins

    • This approach is functionally equivalent to improving mass spectrometer detection sensitivity

  • Dynamic range enhancement:

    • Improving MS dynamic range beyond 100-fold significantly enhances detection capabilities for low-abundance proteins when combined with good detection sensitivity

    • Enhanced peptide separation has similar effects to improving MS dynamic range

A simulated comparison of different experimental designs demonstrated that implementing protein separation and enhancing detection sensitivity should be prioritized before improving peptide separation or MS dynamic range when targeting comprehensive proteome coverage .

Experimental Design ParameterInitial SettingOptimized SettingImpact on Low-Abundance Detection
Protein SeparationNoneMultiple fractionsHigh positive impact
MS Detection Sensitivity1 fmol<0.1 fmolHigh positive impact
Sample Load0.1 μg>1 μgHigh positive impact
MS Dynamic Range100-fold>1,000-foldModerate impact (significant when combined with good sensitivity)

How can researchers address the challenge of protein misfolding when working with recombinant TMEM263?

As a transmembrane protein, TMEM263 presents particular challenges for recombinant expression and proper folding. Researchers can implement several strategies to address these challenges:

  • Expression system optimization:

    • While E. coli systems are common for recombinant protein production, transmembrane proteins often require eukaryotic expression systems

    • Xenopus oocytes present an excellent native-like environment for expression and functional studies of transmembrane proteins

    • Insect cell systems (Sf9, Sf21) may provide alternatives with high expression yields

  • Membrane protein solubilization approaches:

    • Careful detergent selection based on TMEM263's predicted structure

    • Screening of multiple detergent classes (maltosides, glucosides, phosphocholines)

    • Consideration of lipid-like peptides or nanodiscs for maintaining native-like membrane environment

  • Folding assessment methods:

    • Circular dichroism spectroscopy to evaluate secondary structure content

    • Limited proteolysis to assess conformational stability

    • Functional assays to confirm proper folding through activity measurements

  • Protein engineering strategies:

    • Fusion tags that enhance solubility while minimizing interference with folding

    • Truncation constructs to identify stable domains if full-length expression is problematic

    • Glycosylation site engineering to improve folding efficiency in eukaryotic systems

When working with Xenopus oocytes specifically, researchers should note that while they perform many post-translational modifications efficiently, occasional differences from native cells might affect proper folding of certain proteins . Including positive controls with known folding characteristics can help distinguish experimental issues from protein-specific challenges.

How should researchers interpret conflicting TMEM263 protein-protein interaction data?

When faced with contradictory findings regarding TMEM263 protein interactions, researchers should implement a systematic approach to resolution:

  • Evaluate methodological differences:

    • Different interaction detection methods have varying sensitivities and limitations

    • Co-immunoprecipitation followed by mass spectrometry (the method that identified TMEM263 interaction with GH1 ) typically detects stable interactions

    • Proximity labeling approaches may capture more transient interactions

    • Yeast two-hybrid systems can detect direct binary interactions but may miss complex-dependent interactions

  • Consider cellular context variations:

    • Interactions documented in human systems may differ from those in Xenopus

    • Developmental stage-specific interactions may not be conserved across all contexts

    • Subcellular localization differences can affect interaction opportunities

  • Validate interactions through orthogonal approaches:

    • Combine multiple interaction detection methods

    • Implement functional validation through co-expression studies in Xenopus oocytes

    • Use structure-guided mutagenesis to identify critical interaction interfaces

  • Establish interaction hierarchies:

    • Primary vs. secondary interactions

    • Direct vs. indirect associations within protein complexes

    • Determine biological significance through functional impact assessment

The TMEM263 interaction with growth hormone 1 was identified through co-immunoprecipitation followed by mass spectrometry , while interaction with potassium channels was established through different methodologies. Validating these interactions specifically in the Xenopus system would be a valuable contribution to understanding TMEM263 function in this model organism.

What statistical approaches are most appropriate for analyzing TMEM263 expression changes during Xenopus development?

Analysis of TMEM263 expression across developmental stages requires robust statistical approaches tailored to time-series proteomic data:

  • Normalization strategies:

    • Global normalization methods may be insufficient for developmental proteomics

    • Stage-specific internal standards should be considered

    • Normalization to housekeeping proteins with stable expression across development

  • Time-series analysis methods:

    • Clustering approaches to identify proteins with similar expression patterns

    • Principal component analysis to identify major sources of variation

    • Differential expression analysis with time as a continuous variable

  • Multiple testing correction:

    • Developmental proteomics involves thousands of proteins measured across multiple timepoints

    • Appropriate false discovery rate (FDR) control is essential

    • Methods like Benjamini-Hochberg or more stringent Bonferroni correction depending on discovery vs. validation goals

  • Correlation analysis with phenotypes:

    • Correlation of TMEM263 expression changes with developmental milestones

    • Integration with morphological or functional measurements

    • Pathway analysis to identify co-regulated networks

In previous large-scale Xenopus developmental proteomics studies, researchers successfully quantified expression changes of nearly 4,000 proteins during early development, organizing them into expression pattern clusters . Similar approaches can be applied specifically to TMEM263 and its potential interaction partners to identify coordinated expression changes with functional significance.

What are the most promising applications of CRISPR/Cas9 technology for studying TMEM263 function in Xenopus?

CRISPR/Cas9 genome editing technology offers powerful approaches for elucidating TMEM263 function in Xenopus:

  • Precise genetic knockout models:

    • Complete gene knockout to assess developmental consequences

    • Domain-specific modifications to determine structure-function relationships

    • Conditional knockout strategies to bypass early developmental requirements

  • Knockin approaches for functional studies:

    • Endogenous tagging for accurate localization and interaction studies

    • Reporter gene fusions to track expression dynamics in living embryos

    • Introduction of human variants to assess evolutionary conservation of function

  • High-throughput functional screening:

    • Multiplex CRISPR targeting of TMEM263 pathway components

    • Combinatorial editing to assess genetic interactions

    • Saturation mutagenesis of regulatory regions to map expression control elements

  • Disease model development:

    • Introduction of mutations analogous to those identified in human GWAS studies associated with bone mineral density

    • Generation of models mimicking the autosomal dwarfism phenotype observed in chickens

    • Engineering of conditional systems to study postnatal functions separate from developmental roles

When implementing CRISPR approaches in Xenopus, researchers should consider the tetraploid nature of Xenopus laevis, which may require targeting multiple alleles to achieve complete loss of function. Xenopus tropicalis, being diploid, may offer advantages for certain genetic studies while maintaining the benefits of the Xenopus model system.

How might integration of multi-omics data enhance understanding of TMEM263 function in Xenopus development?

A comprehensive multi-omics approach would significantly advance understanding of TMEM263 function:

  • Integrated genomics, transcriptomics, and proteomics:

    • Correlation of genetic variation with expression changes

    • Analysis of post-transcriptional regulation through RNA-protein comparisons

    • Identification of regulatory networks controlling TMEM263 expression

  • Proteomics and interactomics integration:

    • Temporal mapping of TMEM263 protein interaction networks across development

    • Correlation of interaction dynamics with functional outcomes

    • Identification of protein complexes and their developmental regulation

  • Metabolomics correlation:

    • Association of TMEM263 expression with metabolic changes during development

    • Identification of biochemical pathways influenced by TMEM263 function

    • Metabolic consequences of TMEM263 dysfunction

  • Structural biology integration:

    • Mapping of interaction interfaces identified through proteomics onto structural models

    • Structure-guided hypothesis generation about molecular mechanisms

    • Rational design of experimental probes based on structural insights

Previous large-scale studies have already established methodologies for quantitative proteomics of Xenopus laevis embryos, successfully measuring expression kinetics of 3,983 proteins during early development . Expanding this approach to specifically focus on TMEM263 and its interaction network would provide unprecedented insight into its developmental functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.