Recombinant Xenopus laevis UPF0668 protein C10orf76 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
armh3; Armadillo-like helical domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-689
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Protein Sequence
MAQIEKKVGLLRKSSASKKPLKEKVVLMYDEIFTKEDPTKSNPRFWDELFLMKVNIEYLE SKLESLDGEELMKLKDNINSLFQHCIHALRAEHQIRVVNSLQTLCALIRGVHQKNKPTSG FDIINMLMGFDKAELRMKNLMESLDLLLCGDGSESLKSLCLKLLLCLVTVTDNISQNTIL EYVMINSIFEAILQILSNPLSRRQHGYDAVVLLALLVNYRKYESVNPYIVKLSIVDDENT LNGMGLVIARALFEYNRQYTDKEEENQTGFFSALTNMVGSMFIADADEKISVQTNEAILL ALYEAVHLNRNFITVLAQSHPEMGLVAVPISPIPTTPTSPLGTTPPSSDVISPTELPMDA DVQTSNLLITFLKYSSIVMQDTKDEHRLNSGKLCLIILTCIAEDQYANAFLHDDNMNFRV NLHRMPMRHRKKAADKNIPCRPLVCAVLDLMVEFIVTHMMKDFPMDLYTRCIQIVHKVLC YQKKCRVRLHYTWRELWLALINLLKFLMSNETVLLAKHNIFTLTLMVVNLFNMFITYGDT FLPTPSSYDELYYEIIRMHQIFDNLYSMVLRLSTNAGQWKEPASKVTHSLVNIRAIINHF NPKIESYAAVNHISQLSEEQVLEVVRSNYDTLTLKLQDGLDQYERYSEQHKEAAFFKELA RSISINVRKNVAFNTLSQEILLKEFSTIS
Uniprot No.

Target Background

Function
May be involved in Golgi apparatus maintenance and protein secretion.
Database Links

KEGG: xla:446861

UniGene: Xl.32918

Protein Families
UPF0668 family
Subcellular Location
Golgi apparatus membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What is the UPF0668 protein C10orf76 homolog in Xenopus laevis?

The UPF0668 protein C10orf76 homolog is a full-length protein (689 amino acids) found in Xenopus laevis (African clawed frog). It belongs to the UPF0668 family, with the specific UniProt accession number Q6DCT2 . The protein's function is not fully characterized (hence the "UPF" designation which stands for "Uncharacterized Protein Family"), but it is homologous to the human C10orf76 protein. The protein has a complete amino acid sequence starting with MAQIEKKVGLLRKSSASKKPLKEK and contains various structural domains that suggest potential roles in cellular processes .

What expression systems are commonly used for producing this recombinant protein?

The most documented expression system for the Xenopus laevis UPF0668 protein C10orf76 homolog is Escherichia coli (E. coli). This bacterial expression system efficiently produces the full-length protein (amino acids 1-689) with an N-terminal His-tag for purification purposes . The bacterial expression system is preferred for its cost-effectiveness, scalability, and ability to produce significant quantities of the recombinant protein for research applications. Alternative expression systems, such as insect or mammalian cells, may be considered when post-translational modifications are critical for experimental purposes.

How should the recombinant protein be stored and handled to maintain activity?

For optimal storage and handling of Recombinant Xenopus laevis UPF0668 protein C10orf76 homolog:

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom before opening

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Store at -20°C/-80°C in small working aliquots to prevent freeze-thaw cycles

  • For working solutions, store aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .

How can immunodepletion techniques be applied to study this protein in Xenopus egg extracts?

Immunodepletion in Xenopus egg extracts is a powerful technique to study the function of UPF0668 protein C10orf76 homolog:

  • Preparation of antibody-coupled beads:

    • Wash Protein A Dynabeads with antibody washing/coupling buffer

    • Incubate beads with specific antibodies against UPF0668 protein C10orf76 homolog

    • Wash to remove unbound antibodies

  • Immunodepletion procedure:

    • Incubate the prepared beads with CSF-arrested Xenopus laevis egg extract

    • Allow the antibody to capture the target protein

    • Magnetically separate the beads containing the immunocomplexes

    • Collect the depleted extract for experimental use

  • Verification:

    • Analyze the depletion efficiency using Western blot

    • Consider potential co-depletion of interacting proteins

This method allows researchers to examine the phenotypic consequences of removing the protein from the extract, providing insights into its functional role in various cellular processes.

What are the recommended methods for protein add-back experiments?

Two primary methods are recommended for protein add-back experiments after immunodepletion:

Method 1: Recombinant Protein Add-Back

  • Dialyze purified recombinant protein into a compatible buffer (phosphate or HEPES-based)

  • Concentrate to at least 20× the endogenous concentration

  • Add directly to the depleted extract

  • Analyze reconstitution levels via Western blot

Method 2: mRNA Expression Method

  • Prepare template DNA with appropriate promoter (SP6 or T7)

  • Perform in vitro transcription using mMESSAGE mMACHINE kit

  • Purify the mRNA

  • Add mRNA directly to the depleted extract for in vitro translation

  • Monitor protein expression

Comparison of methods:

ParameterRecombinant ProteinmRNA Expression
Concentration controlHighVariable
ReproducibilityHighDepends on extract quality
Ease of useRequires protein purificationSimpler for difficult-to-purify proteins
Suitability for complexesLimitedExcellent for protein complexes
Time requirementImmediate useRequires translation time

The choice between these methods depends on experimental requirements, protein properties, and whether protein complexes need to be reconstituted .

What purification strategies are most effective for this His-tagged protein?

For optimal purification of His-tagged UPF0668 protein C10orf76 homolog:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Use Ni-NTA or Co2+-based resins for primary capture

    • Employ a gradient elution with increasing imidazole concentration (20-250 mM)

    • Monitor elution fractions via SDS-PAGE

  • Secondary Purification:

    • Apply size exclusion chromatography to remove aggregates and achieve >90% purity

    • Consider ion exchange chromatography if charged contaminants remain

  • Buffer Optimization:

    • Dialyze into a phosphate or HEPES-based buffer compatible with downstream applications

    • Avoid Tris buffers which can interfere with Xenopus egg extract systems

The purified protein typically achieves >90% purity as determined by SDS-PAGE analysis and can be concentrated to the required levels for experimental applications .

How can I optimize expression of the recombinant protein in E. coli?

To optimize expression of Recombinant Xenopus laevis UPF0668 protein C10orf76 homolog in E. coli:

  • Strain Selection:

    • BL21(DE3) derivatives are commonly used for their reduced protease activity

    • Rosetta or CodonPlus strains help overcome codon bias issues

  • Expression Conditions:

    • Induction at OD600 of 0.6-0.8 with 0.1-1.0 mM IPTG

    • Lower temperature expression (16-25°C) may improve solubility

    • Extended expression times (overnight) at lower temperatures

  • Media Optimization:

    • Rich media (LB, TB, 2YT) for higher yield

    • Auto-induction media for time-efficient expression

    • Consider supplementing with trace elements and additional glucose

  • Solubility Enhancement:

    • Co-expression with chaperones if solubility is an issue

    • Addition of solubility-enhancing fusion tags (in addition to His-tag)

    • Optimization of lysis conditions (detergents, salt concentration)

Monitoring expression levels at different timepoints via SDS-PAGE and ensuring proper sample preparation (sonication, French press) can significantly improve yield and quality of the recombinant protein.

How can I address protein aggregation issues during reconstitution?

When facing aggregation of Recombinant Xenopus laevis UPF0668 protein C10orf76 homolog:

  • Optimize Reconstitution Conditions:

    • Reduce protein concentration during initial reconstitution

    • Add reconstitution buffer slowly while gently rotating the vial

    • Avoid vigorous shaking or vortexing that can cause protein denaturation

  • Buffer Composition Adjustments:

    • Test different pH values (typically 7.0-8.0)

    • Include stabilizing agents like 1-5% glycerol or 0.1-0.5M NaCl

    • Consider low concentrations (1-5 mM) of reducing agents like DTT or β-mercaptoethanol

  • Temperature Management:

    • Perform reconstitution at 4°C rather than room temperature

    • Allow slow warming to experimental temperature

  • Filtration Techniques:

    • Use a 0.22 μm filter to remove larger aggregates

    • Consider centrifugation at 14,000g for 10 minutes to pellet insoluble material

If aggregation persists, dialyzing the protein against fresh buffer or performing size exclusion chromatography can help remove aggregated species before experimental use.

What are common challenges when working with this protein in Xenopus egg extracts?

Researchers face several challenges when working with UPF0668 protein C10orf76 homolog in Xenopus egg extracts:

  • Extract Compatibility:

    • Buffer compatibility issues with purified protein

    • Potential interference from endogenous proteins

    • Solution: Dialyze protein into phosphate or HEPES buffers; avoid Tris buffers

  • Depletion Efficiency:

    • Incomplete immunodepletion

    • Co-depletion of interacting partners

    • Solution: Multiple rounds of immunodepletion; careful validation of depletion specificity

  • Protein Activity Preservation:

    • Loss of functional activity after purification

    • Solution: Minimize freeze-thaw cycles; maintain glycerol in storage buffer

  • Concentration Effects:

    • Determining appropriate add-back concentrations

    • Solution: Add purified protein at 20× endogenous concentration to compensate for potential activity loss

  • Extract Quality Variation:

    • Batch-to-batch variability of Xenopus egg extracts

    • Solution: Include appropriate controls; perform experiments with multiple extract preparations

Documenting these challenges and solutions in laboratory protocols can significantly improve experimental reproducibility.

How can structure-function relationships be investigated using mutational analysis of this protein?

To investigate structure-function relationships in UPF0668 protein C10orf76 homolog:

  • Domain Identification and Mutation Strategy:

    • Analyze the 689-amino acid sequence to identify conserved domains

    • Design point mutations or domain deletions based on sequence conservation

    • Focus on highly conserved residues or motifs across species

  • Recombinant Expression of Mutants:

    • Generate expression constructs with specific mutations

    • Express in E. coli using the same protocol as wild-type protein

    • Compare expression levels and solubility with wild-type

  • Functional Assay Design:

    • Develop assays to test specific activities before and after mutation

    • Combine with immunodepletion and add-back experiments in Xenopus egg extracts

    • Use mRNA expression method for difficult-to-purify mutants

  • Structural Analysis:

    • Perform circular dichroism to assess secondary structure changes

    • Consider limited proteolysis to identify structural domains

    • When possible, obtain crystal structures of wild-type and mutant proteins

This approach can reveal critical residues for protein function and provide insights into the molecular mechanisms of this poorly characterized protein.

What techniques can be used to identify interaction partners of this protein in Xenopus laevis systems?

Several complementary techniques can identify interaction partners of UPF0668 protein C10orf76 homolog:

  • Immunoprecipitation from Xenopus Egg Extracts:

    • Use antibodies against the UPF0668 protein to pull down protein complexes

    • Analyze co-precipitating proteins via mass spectrometry

    • Validate interactions via reciprocal immunoprecipitation

  • Proximity-Dependent Labeling:

    • Express the protein fused to BioID or APEX2 in Xenopus systems

    • Allow biotin labeling of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Yeast Two-Hybrid Screening:

    • Use the UPF0668 protein as bait against a Xenopus cDNA library

    • Screen for positive interactions under various stringency conditions

    • Validate using other methods in Xenopus systems

  • In Vitro Binding Assays:

    • Express and purify potential binding partners

    • Perform pull-down assays with recombinant His-tagged UPF0668 protein

    • Quantify binding affinities using techniques like surface plasmon resonance

Combining these approaches provides a comprehensive view of the protein's interaction network and potential functional roles in Xenopus laevis systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.