Recombinant Xenopus laevis UPF0694 transmembrane protein C14orf109 homolog B

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem251-b; Transmembrane protein 251-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem251-b
Target Protein Sequence
MMNFRQRMGWIGVSLYLFVSAAAFYYVFEINETYNRLALEHVQLKPHEPHRGTTWTHSLK IRLLSLPFWLWAALFLIPYFQVFLFLYSCTRADPKTVGYCIIPICLAIICNRHQSFVKAS NRISKLQLIDT
Uniprot No.

Target Background

Database Links

KEGG: xla:444608

UniGene: Xl.32400

Protein Families
TMEM251 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does Recombinant Xenopus laevis UPF0694 transmembrane protein C14orf109 homolog B differ from homolog A?

While both homologs share significant sequence similarity and identical length (131 amino acids), key differences can be observed in their amino acid sequences. Comparing the sequences:

FeatureHomolog A (tmem251-a)Homolog B (tmem251-b)
UniProt IDQ66J17Q6GLZ9
Length131 aa131 aa
Key sequence variationsPosition 36: D
Position 43: Q
Position 52: A
Position 66: T
Position 36: E
Position 43: H
Position 52: I
Position 66: A
C-terminal regionNQISRLQLIDTNRISKLQLIDT

These sequence differences may contribute to potential functional divergence between the two homologs, which may be relevant for experimental design and interpretation of results .

What are the optimal storage and reconstitution protocols for Recombinant Xenopus laevis UPF0694 transmembrane protein C14orf109 homolog B?

For optimal results when working with this recombinant protein, follow these methodological guidelines:

Storage Protocol:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Perform aliquoting for multiple use applications

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

The protein is supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which provides stability during storage and reconstitution processes .

What experimental systems can be used to study the function of Xenopus laevis tmem251-b in relation to endoplasmic reticulum dynamics?

Xenopus laevis provides an excellent model system for studying transmembrane proteins and their roles in cellular processes. Based on research involving Xenopus ER dynamics, the following experimental approaches are recommended:

  • In vitro reconstitution assays: Using Xenopus egg extracts, embryo extracts, and somatic Xenopus tissue culture cell (XTC) extracts to study protein-mediated organelle motility

  • Video-enhanced differential interference contrast microscopy: This technique allows direct visualization of ER tubule movements and can be used to assess the potential role of tmem251-b in microtubule-based ER motility

  • Directionality assays: These can determine if tmem251-b influences or participates in plus-end or minus-end directed ER movement along microtubules

  • Developmental studies: Comparing protein function across different embryonic stages to assess potential developmental regulation of tmem251-b activity

Research has shown that ER motility mechanisms differ between early development (exclusively dynein-driven) and somatic cells (bidirectional movement involving both dynein and kinesin motors) in Xenopus laevis. These established experimental systems could be valuable for investigating potential roles of tmem251-b in these processes .

How can researchers design experiments to examine potential interactions between Xenopus laevis tmem251-b and motor proteins?

When investigating potential interactions between tmem251-b and motor proteins such as kinesin or dynein, consider these methodological approaches:

  • Co-immunoprecipitation assays: Using antibodies against tmem251-b or the His-tag to pull down potential interacting partners, followed by immunoblotting for motor proteins

  • In vitro binding assays: With purified recombinant tmem251-b and motor protein components to assess direct interactions

  • Microtubule co-sedimentation assays: To determine if tmem251-b co-sediments with microtubules in the presence or absence of specific motor proteins

  • Function-blocking antibody experiments: Similar to the SUK4 antibody approach used to block conventional kinesin function in ER motility studies

  • Comparative analysis between developmental stages: Based on the finding that plus end-directed ER motility emerges in somatic cells but not in early embryonic stages, researchers can examine if tmem251-b expression or modification correlates with this transition

These approaches would help determine if tmem251-b plays a role in the developmental regulation of organelle transport mechanisms in Xenopus laevis .

What strategies can be employed to investigate the membrane topology and insertion mechanisms of tmem251-b?

To characterize the membrane topology and insertion mechanisms of this transmembrane protein:

  • Protease protection assays: Treating membrane preparations containing tmem251-b with proteases, followed by immunoblotting to determine which regions are protected by the membrane

  • Glycosylation mapping: Introduction of glycosylation sites at various positions within tmem251-b to determine luminal versus cytoplasmic orientation

  • Fluorescence techniques: Using GFP-fusion constructs with the N- or C-terminus of tmem251-b, combined with selective membrane permeabilization techniques

  • Cysteine accessibility methods: Site-directed mutagenesis to introduce cysteine residues at specific positions, followed by labeling with membrane-permeable or impermeable sulfhydryl reagents

These approaches would provide crucial information about how tmem251-b is oriented within membranes, which is essential for understanding its potential function .

How conserved is tmem251-b across species, and what might this suggest about its function?

The UPF0694 transmembrane protein C14orf109 homolog is found across numerous vertebrate species, suggesting evolutionary conservation of function. Comparative analysis can provide insights into functional conservation:

SpeciesProtein NameNotable Features
Xenopus laevistmem251-b131 amino acids, subject of this FAQ
Xenopus laevistmem251-a131 amino acids, homeolog with slight sequence variations
Xenopus tropicalistmem251Closely related to X. laevis homologs
ChickenTMEM251 (RP11-371E8.4)Also known as C5H14orf109
MouseTmem251Also known as D230037D09Rik
BovineTMEM251Also known as C21H14orf109
PigTMEM251-

Researchers should consider:

  • Performing multiple sequence alignments to identify highly conserved residues that may be critical for function

  • Focusing functional studies on conserved regions to maximize relevance across species

  • Using evolutionary analysis to identify potential species-specific adaptations

  • Comparing expression patterns across species to identify conserved developmental regulation

The presence of this protein across diverse vertebrate species suggests it may play a fundamental role in cellular processes rather than species-specific functions .

What experimental approaches can distinguish the functions of tmem251-a and tmem251-b in Xenopus laevis?

Xenopus laevis, as a pseudotetraploid organism, often contains two copies of genes that are single copies in diploid organisms. The presence of both tmem251-a and tmem251-b homologs presents both challenges and opportunities for researchers. Consider these methodological approaches:

  • Paralog-specific knockdown: Design morpholinos or CRISPR-Cas9 guide RNAs targeting unique regions of each paralog to selectively reduce expression

  • Rescue experiments: After knockdown of both paralogs, perform rescue experiments with individual paralogs to identify unique versus redundant functions

  • Spatiotemporal expression analysis: Use paralog-specific probes for in situ hybridization or RT-PCR to determine if expression patterns differ during development or across tissues

  • Yeast two-hybrid or BioID experiments: Identify potential protein-protein interactions that might differ between the two paralogs

  • Chimeric protein construction: Create chimeric proteins containing domains from both paralogs to map functional regions

This experimental framework would help determine whether these paralogs have undergone subfunctionalization or neofunctionalization since their divergence, providing insights into their respective biological roles .

What are common challenges in working with recombinant transmembrane proteins like tmem251-b, and how can researchers overcome them?

Working with transmembrane proteins presents several technical challenges. Here are evidence-based solutions for addressing common issues:

  • Protein solubility issues:

    • Add appropriate detergents (e.g., n-Dodecyl β-D-maltoside or CHAPS) during reconstitution

    • Consider using membrane-mimetic systems like nanodiscs or liposomes

    • Optimize buffer conditions (pH, salt concentration)

  • Protein aggregation:

    • Avoid repeated freeze-thaw cycles

    • Maintain consistent temperature during handling

    • Add stabilizing agents like glycerol (5-50%) as recommended in protocols

    • Use freshly prepared protein for critical experiments

  • Poor antibody recognition:

    • Utilize the His-tag for detection when paralog-specific antibodies are unavailable

    • For generating new antibodies, target unique sequences between tmem251-a and tmem251-b

  • Inefficient incorporation into experimental membrane systems:

    • Optimize protein:lipid ratios for reconstitution

    • Consider protein orientation during reconstitution

    • Verify insertion using protease protection assays

  • Functional assay development:

    • Begin with in vitro systems before moving to cellular contexts

    • Consider the native environment of the protein in experimental design

    • Establish appropriate positive and negative controls

Careful optimization of these parameters will significantly improve experimental outcomes when working with recombinant tmem251-b .

What are promising research directions for investigating the functional role of tmem251-b in cellular processes?

Based on current knowledge and technical capabilities, several research directions hold particular promise:

  • Organelle localization studies:

    • Determine the subcellular localization of tmem251-b (ER, Golgi, plasma membrane)

    • Investigate potential dynamic relocalization during cell cycle or development

    • Examine colocalization with known organelle markers

  • Interactome analysis:

    • Perform BioID or proximity labeling experiments to identify interacting proteins

    • Conduct co-immunoprecipitation followed by mass spectrometry

    • Validate key interactions through secondary methods

  • Developmental expression profiling:

    • Map expression across embryonic stages in Xenopus laevis

    • Correlate expression with key developmental transitions

    • Compare with expression of known organelle movement regulators

  • Structure-function analysis:

    • Generate point mutations in conserved residues

    • Create domain deletion constructs

    • Perform functional complementation assays

  • Integration with cellular machinery studies:

    • Investigate potential roles in membrane trafficking

    • Explore relationships with cytoskeletal dynamics

    • Examine possible functions in organelle tethering or fusion

These approaches would significantly advance understanding of the biological function of this poorly characterized transmembrane protein in developmental and cellular contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.