Recombinant Xenopus laevis Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The Recombinant Xenopus laevis VMA21 protein refers to a recombinant version of the vma21 gene product from the African clawed frog (Xenopus laevis), engineered for experimental or therapeutic use. VMA21 is a critical assembly factor for the vacuolar ATPase (V-ATPase), a proton pump responsible for acidifying cellular compartments like lysosomes and Golgi apparatus . In humans, VMA21 mutations are linked to X-linked myopathy with excessive autophagy (XMEA) and hepatic dysfunction . While human VMA21 is well-studied, the Xenopus laevis homolog remains understudied, with limited data on its recombinant form.

Functional Role of VMA21 in V-ATPase Assembly

VMA21 facilitates the assembly of the V₀ domain of the V-ATPase in the endoplasmic reticulum (ER). Key functions include:

  • Subunit interaction: Binds proteolipid subunits (e.g., c′) to form the V₀ ring structure .

  • ER retention: Ensures proper trafficking of V₀ to the Golgi for V₁ domain coupling .

  • Species conservation: In Xenopus, vma21 shares functional homology with human and yeast orthologs, though specific mechanisms remain uncharacterized .

VMA21 FunctionHuman OrthologXenopus laevis (Inferred)
V₀ domain assemblyCritical for lysosomal acidification Likely similar ER/Golgi role
Glycosylation defectsLinked to hepatic steatosis Not reported
Disease associationXMEA, hepatopathy Unknown

Human VMA21 Insights

Human studies highlight VMA21’s role in:

  • Lysosomal dysfunction: Mutations impair proton pumping, reducing autophagy efficiency and causing lipid droplet accumulation .

  • Cancer biology: Elevated VMA21 expression correlates with favorable prognosis in colorectal cancer (CRC), suggesting tumor-suppressive effects .

Xenopus-Specific Data

  • Gene ID: XB-GENE-5730849 .

  • Function: Required for V₀ complex assembly in the ER .

  • Expression: Limited data; inferred from conserved synteny with human homologs .

Hypothesized Roles in Xenopus Models

  1. Developmental studies: VMA21’s role in ER-Golgi trafficking could inform embryonic patterning or organogenesis.

  2. Disease modeling: Recombinant VMA21 may aid in studying autophagy-related pathologies in Xenopus, akin to human XMEA .

  3. Cancer research: Leveraging VMA21’s tumor-suppressive properties (as seen in CRC ) for therapeutic exploration.

Technical and Knowledge Gaps

  • Recombinant protein characterization: No available data on expression systems, purification, or activity assays for Xenopus VMA21.

  • Structural biology: Lack of crystallographic or cryo-EM studies to compare Xenopus and human VMA21.

  • Functional redundancy: Uncertainty about overlapping roles with other V-ATPase assembly factors (e.g., TMEM199, CCDC115) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
vma21; Vacuolar ATPase assembly integral membrane protein vma21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
vma21
Target Protein Sequence
MERYDKAALNAADVPPPSFSQNGGSLVSTLKTLLFFTILMIMLPIGLYFSSKVYVFEGTY GMSNRDSYFYAAIVAVVAVHVVLAMFVYVAWNEGSPQWREGKQD
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Database Links

KEGG: xla:734541

UniGene: Xl.5315

Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and cellular localization of VMA21 in Xenopus laevis?

VMA21 is a multi-transmembrane protein localized primarily to the endoplasmic reticulum (ER). In Xenopus laevis, as in humans, VMA21 contains multiple transmembrane domains with a critical luminal loop region. The protein shows high conservation across vertebrate species, with critical residues like Arg18 and Asn63 being particularly conserved. Unlike its yeast homolog, the Xenopus VMA21 lacks the C-terminal dilysine motif necessary for ER retrieval, suggesting evolved differences in trafficking mechanisms . The protein's structure facilitates its central role in V-ATPase assembly through interactions with V₀ domain components.

How does VMA21 contribute to V-ATPase assembly?

VMA21 functions as a dedicated assembly factor for the V-ATPase complex, specifically facilitating the assembly of the V₀ domain in the ER. Methodologically, this can be demonstrated through protein interaction studies showing that VMA21:

  • Directly interacts with V₀ subunits like ATP6V0C

  • Associates with other assembly factors including ATP6AP2

  • Functions early in the assembly pathway, before V₀-V₁ domain integration

These interactions are critical for proper V-ATPase assembly. When VMA21 function is compromised, there is a reduction in V₀ subunit expression (ATP6V0D1 and ATP6V0C), while V₁ subunits (ATP6V1D1 and ATP6V1B1/2) remain unaffected . This selective impact occurs because V₁ domain assembly happens independently in the cytosol, while V₀ assembly requires ER-based factors like VMA21.

What experimental approaches can verify VMA21's function in proton pump activity?

The following methodological approaches provide robust verification of VMA21's role in proton pump function:

  • Yeast complementation assays: Wild-type human VMA21 can rescue growth defects in yeast lacking Vma21p when grown in media with elevated zinc concentrations. This approach leverages the dependence of yeast on functional V-ATPase for survival under these conditions. Mutant forms of VMA21 show reduced rescue capacity, providing a quantifiable measure of functional impairment .

  • Lysosomal acidification assays: Using pH-sensitive fluorescent dyes:

    • LysoSensor: Emits fluorescence only in acidic compartments with intensity inversely correlated with pH

    • LysoTracker: Labels acidic organelles

  • Enzymatic activity assays: Measuring cathepsin B (CTSB) activity using peptide-conjugated fluorophores (e.g., cresyl violet) that are cleaved by active CTSB, providing a functional readout of lysosomal acidification and protease activation .

What are the optimal approaches for expressing recombinant Xenopus VMA21 in experimental systems?

For successful recombinant expression of Xenopus laevis VMA21, researchers should consider these methodological approaches:

  • Expression system selection:

    • Mammalian cells (HEK293T) provide proper post-translational modifications and membrane targeting

    • Baculovirus-insect cell systems offer higher yields while maintaining eukaryotic processing

    • Avoiding bacterial systems due to the multiple transmembrane domains that require eukaryotic membrane machinery

  • Vector design considerations:

    • Include epitope tags (Myc, FLAG) for detection and purification

    • Position tags at the C-terminus to avoid interfering with ER targeting signals

    • Consider codon optimization for the expression system

  • Validation approaches:

    • Western blotting for expression level quantification

    • Immunofluorescence for subcellular localization

    • Co-immunoprecipitation to verify interactions with V₀ subunits and assembly factors

When expressing VMA21 variants, researchers should monitor both mRNA (through qPCR) and protein levels, as mutations can affect either transcript stability or protein stability, as observed with various VMA21 mutations that reduce both mRNA and protein levels .

How can researchers effectively assess V-ATPase assembly defects resulting from VMA21 mutations?

A comprehensive approach to assessing V-ATPase assembly defects includes:

  • Biochemical assessment:

    • Western blot analysis of V₀ subunits (ATP6V0D1, ATP6V0C) and V₁ subunits (ATP6V1D1, ATP6V1B1/2)

    • Blue native PAGE to analyze intact complex formation

    • Sucrose gradient fractionation to separate assembled and unassembled components

  • Functional assessment:

    • Proton transport assays using isolated organelles

    • Whole-cell lysosomal acidification measurement with ratiometric probes

    • Bafilomycin A1 (V-ATPase inhibitor) as a positive control

  • Protein interaction studies:

    • Co-immunoprecipitation of VMA21 with ATP6AP2 and V₀ subunit ATP6V0C

    • Quantification of interaction efficiency between wild-type vs. mutant VMA21

    • Assessment of ER retention of V₀ components

Assessment ParameterWild-type VMA21VMA21 Mutations (Range from Studies)
V₀ subunit levels100%30-70% of control
Interaction with ATP6AP2StrongReduced (mutation-dependent)
Lysosomal acidificationNormalSignificantly impaired
CTSB enzyme activity100%20-40% of control

What methods can be used to study VMA21 conservation between Xenopus laevis and other species?

Researchers can employ these approaches to study evolutionary conservation:

  • Sequence analysis methods:

    • Multiple sequence alignments using CLUSTAL, MUSCLE, or T-Coffee

    • Conservation scoring of amino acid positions using ConSurf

    • Phylogenetic tree construction to visualize evolutionary relationships

  • Functional complementation:

    • Cross-species rescue experiments where Xenopus VMA21 is expressed in human or yeast cells with VMA21 deficiency

    • Quantitative growth assays in yeast under non-permissive conditions

    • Assessment of V-ATPase assembly rescue in mutant cells

  • Structural prediction and validation:

    • Homology modeling based on related structures

    • Validation of critical residues through site-directed mutagenesis

    • Comparison of predicted transmembrane topologies

The high conservation of VMA21 across species makes Xenopus an excellent model for studying fundamental aspects of V-ATPase assembly. Key residues like Arg18 and Asn63 show strong conservation between Xenopus laevis, human, and mouse variants, suggesting functional importance across vertebrates .

How does VMA21 dysfunction affect autophagy pathways in model systems?

VMA21 dysfunction profoundly impacts autophagy through several interconnected mechanisms:

  • Impaired lysosomal acidification: Loss of VMA21 function reduces V-ATPase activity, leading to:

    • Decreased proteolytic enzyme activation due to suboptimal pH

    • Reduced degradative capacity of autolysosomes

    • Accumulation of undegraded material in enlarged lysosomal structures

  • Lipophagy disruption: VMA21 deficiency specifically impairs lipid droplet degradation:

    • Accumulation of lipid droplets in autolysosomes

    • Incomplete degradation of lipid components

    • Potential contribution to steatosis in hepatocytes

  • Lysosomal morphology alterations:

    • Increased LAMP1 expression detected by both immunofluorescence and western blotting

    • Enlarged LAMP1-positive vesicles suggesting impaired organelle turnover

    • Accumulation of autophagic vesicles containing undigested material

Methodologically, researchers can investigate these pathways using:

  • LC3-II/LC3-I ratio assessment by western blot

  • Fluorescent LC3 puncta quantification

  • Co-localization studies between LC3 and LAMP1

  • Electron microscopy to visualize accumulated autophagic structures

  • Live-cell imaging of lipid droplet turnover using fluorescent lipid analogs

What is the relationship between VMA21 mutations and disease phenotypes?

VMA21 mutations are associated with distinct clinical phenotypes through mechanisms that can be studied using these research approaches:

  • X-linked myopathy with excessive autophagy (XMEA):

    • Characterized by progressive vacuolization and atrophy of skeletal muscle

    • Ranges from mild onset after age 5 with slow progression to severe congenital forms

    • Associated with specific VMA21 variants (e.g., G91A)

  • Autophagic hepatopathy with abnormal glycosylation:

    • Characterized by chronic hypertransaminasemia, mild hyperlipidemia with increased LDL cholesterol

    • Shows steatohepatitis with lipid accumulation in hepatocytes

    • Associated with different VMA21 variants (e.g., p.Asn63Gly, c.-10C>T, p.Arg18Gly)

Research methodologies to investigate genotype-phenotype correlations include:

  • Patient-derived fibroblast or iPSC studies

  • CRISPR-engineered cellular and animal models

  • Tissue-specific conditional knockout approaches

  • Transcriptomic and proteomic profiling of affected tissues

Clinical PhenotypeAssociated MutationsCellular PhenotypeV-ATPase Activity
XMEAG91A and othersMuscle autophagy defects30-40% of normal
Hepatopathy with CDGp.Asn63Gly, c.-10C>T, p.Arg18GlyLipid droplet accumulation, ER stress20-50% of normal

How can Xenopus laevis be utilized as a model system for studying VMA21 function?

Xenopus laevis offers unique advantages for VMA21 research that can be leveraged through these methodological approaches:

  • Developmental studies:

    • External fertilization and development allows for easy manipulation and observation

    • Staged embryos can be used to study temporal expression patterns of VMA21

    • Microinjection of morpholinos or CRISPR components for targeted gene knockdown/knockout

  • Organ-specific studies:

    • Tadpole transparency enables in vivo imaging of organelles and autophagic processes

    • Metamorphosis provides a natural model for studying tissue remodeling and autophagy

    • Liver development can be studied in the context of VMA21's role in hepatic function

  • Comparative immunity applications:

    • Xenopus immune system is fundamentally similar to mammals

    • Evolutionary distance allows distinguishing conserved vs. species-specific adaptations

    • Can reveal fundamental vs. specialized roles of VMA21 in immunity

  • Technical advantages:

    • Large embryos facilitate microinjection and biochemical analyses

    • Availability of genetically defined inbred strains and clones

    • Established transgenic methodologies for visualization and functional studies

Researchers can leverage the University of Rochester's comprehensive Xenopus laevis Resource for Immunobiology, which maintains various research tools including transgenic animals, monoclonal antibodies, cell lines, and molecular probes .

How can researchers overcome issues with protein stability when working with mutant VMA21 variants?

When working with unstable VMA21 mutants, researchers can employ these methodological approaches:

  • Expression optimization strategies:

    • Use inducible expression systems with titratable promoters

    • Employ lower culture temperatures (30-33°C) to favor proper folding

    • Include chemical chaperones (e.g., 4-PBA, TUDCA) in culture media

  • Protein stabilization approaches:

    • Design fusion constructs with stabilizing partners

    • Test multiple epitope tag positions to find non-disruptive options

    • Engineer disulfide bonds to enhance stability based on structural predictions

  • Analytical considerations:

    • Include proteasome inhibitors during protein extraction

    • Compare mRNA levels (by qPCR) with protein levels to distinguish translational vs. post-translational effects

    • Utilize pulse-chase experiments to determine protein half-life

For mutations that primarily affect protein interactions rather than stability (as seen with overexpressed Myc-tagged VMA21 R18G, VMA21 D63G, and VMA21 G91A), focus on quantitative interaction studies using co-immunoprecipitation followed by western blotting for interaction partners like ATP6AP2 and ATP6V0C .

What approaches can resolve contradictory results between in vitro and in vivo VMA21 studies?

To resolve discrepancies between in vitro and in vivo findings, consider these methodological solutions:

  • System-specific contextual factors:

    • Cell-type specific compensatory mechanisms may mask phenotypes

    • Different tissues have varying V-ATPase subunit isoforms and assembly requirements

    • Temporal development of phenotypes may differ between acute vs. chronic models

  • Integration strategies:

    • Complement cell culture with organoid models that better recapitulate tissue complexity

    • Validate findings across multiple cellular models with different backgrounds

    • Consider tissue-specific conditional knockout/knockdown in animal models

  • Quantitative assessment approaches:

    • Establish dose-response relationships for partial loss of function

    • Develop more sensitive readouts for subtle functional impairments

    • Measure kinetic parameters rather than endpoint measurements

For example, research has shown that while both CDG and XMEA variants of VMA21 show similar impairments in fibroblasts (reduced protein expression, V-ATPase misassembly, and dysfunction), there are subtle differences in ER stress and cholesterol homeostasis that may contribute to the distinct tissue-specific manifestations of these conditions .

How can researchers accurately distinguish between primary and secondary effects of VMA21 dysfunction?

To distinguish primary from secondary effects, implement these methodological approaches:

  • Temporal analysis strategies:

    • Utilize inducible knockdown/knockout systems

    • Perform time-course experiments after VMA21 depletion

    • Monitor the sequential appearance of cellular phenotypes

  • Rescue experiment designs:

    • Complement with wild-type VMA21 to identify reversible effects

    • Use domain-specific mutants to dissect function

    • Apply targeted interventions at different pathway steps to determine dependency relationships

  • Pathway dissection approaches:

    • Inhibit specific downstream pathways (e.g., autophagy, ER stress) to determine contribution to phenotype

    • Compare with other V-ATPase assembly factor deficiencies to identify common vs. unique effects

    • Utilize proteomics to identify early vs. late changes in protein expression

For instance, research on VMA21 deficiency shows that impaired V-ATPase assembly is a primary effect, leading to secondary consequences including defective lysosomal acidification, impaired CTSB activity, and ultimately autophagic defects with lipid droplet accumulation .

What are the emerging techniques for studying VMA21 interactions with the complete V-ATPase assembly machinery?

Cutting-edge methodologies for studying VMA21 in the V-ATPase assembly process include:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy of assembly intermediates

    • Cross-linking mass spectrometry to map interaction interfaces

    • In-cell NMR to study structural dynamics in native environments

  • Proximity labeling technologies:

    • BioID or TurboID fusion proteins to identify proximal interactors during assembly

    • APEX2-based proteomic mapping of the VMA21 microenvironment

    • Split-BioID to capture transient assembly interactions

  • Live-cell visualization techniques:

    • Multi-color single-molecule tracking of assembly components

    • FRET/FLIM-based interaction sensors

    • Lattice light-sheet microscopy for high-resolution 4D imaging of assembly dynamics

These approaches can help resolve the complete sequence of assembly events, identify additional assembly factors, and determine how mutations in VMA21 disrupt specific steps in the assembly pathway.

How might therapeutic approaches targeting VMA21 pathways be developed for related disorders?

Potential therapeutic strategies that could emerge from VMA21 research include:

  • Small molecule approaches:

    • Chemical chaperones to stabilize mutant VMA21 proteins

    • Modulators of V-ATPase activity to compensate for partial assembly defects

    • Compounds that enhance alternative pathways for lysosomal acidification

  • Gene therapy strategies:

    • AAV-based delivery of functional VMA21 to affected tissues

    • CRISPR-based correction of pathogenic variants

    • Antisense oligonucleotides to modulate splicing in mutations affecting mRNA processing

  • Pathway-based interventions:

    • Targeting downstream consequences (e.g., lipid metabolism, ER stress)

    • Autophagy modulators to compensate for defective lysosomal function

    • Tissue-specific interventions tailored to predominant disease manifestations

Research into the mechanisms underlying both VMA21-CDG and VMA21-XMEA phenotypes provides valuable insights for developing targeted therapeutic strategies. The hypomorphic nature of disease-causing variants suggests that even partial restoration of function might provide substantial clinical benefit .

What comparative approaches between species can further elucidate VMA21 evolution and function?

Evolutionary insights into VMA21 function can be gained through these comparative approaches:

  • Cross-species functional studies:

    • Compare Xenopus, mammalian, and yeast VMA21 in complementation assays

    • Identify species-specific interaction partners through comparative proteomics

    • Create chimeric proteins to map functionally divergent domains

  • Evolutionary analysis methods:

    • Synteny analysis to study genomic context conservation

    • Selection pressure analysis to identify sites under positive/negative selection

    • Ancestral sequence reconstruction to test evolutionary hypotheses

  • Comparative disease modeling:

    • Develop Xenopus models of human VMA21 mutations

    • Compare phenotypes across zebrafish, Xenopus, and mouse models

    • Utilize the unique advantages of each model system for different aspects of VMA21 biology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.