Recombinant Xenopus laevis Vang-like protein 2-A (vangl2-a)

Shipped with Ice Packs
In Stock

Description

Protein Isoforms

Research has identified an N-terminally extended isoform of vangl2-a, termed Vangl2-Long, which arises from alternative translation initiation at a near-cognate AUA start codon upstream of the coding region of canonical Vangl2 . This N-terminal extension is conserved across vertebrate species, suggesting functional significance . In protein analyses, Vangl2-Long appears as a 70 kD band, while the canonical Vangl2 appears as a 62 kD band .

IsoformMolecular WeightOriginDetection Method
Vangl2 (canonical)62 kDATG start codonWestern blot with mAb 36E3
Vangl2-Long70 kDAUA near-cognate start codonWestern blot with mAb 36E3

Expression and Developmental Regulation

In Xenopus embryos, both Vangl2 and Vangl2-Long isoforms are expressed throughout development, with precise temporal regulation . Both isoforms are detectable from the earliest cleavage stages, likely from maternal origin . Their expression increases significantly at midblastula transition (stages 8-9) and reaches peak levels during gastrulation and neurulation phases, indicating their importance during these critical developmental periods .

While Vangl2 remains highly expressed from gastrulation through organogenesis, Vangl2-Long shows a significant decline in expression levels from tail bud stage 25 onward . This differential expression pattern suggests distinct developmental roles for the two isoforms and highlights the precise regulatory control governing their expression .

Maternal Expression

Vangl2 is a maternal planar cell polarity core protein in Xenopus, with mRNA expression detectable in oocytes . The maternal contribution of Vangl2 appears to be critical for early developmental processes, as evidenced by its presence prior to zygotic genome activation . This maternal expression underscores the protein's importance in establishing early cellular asymmetries essential for proper embryonic development.

Subcellular Localization and Distribution

The subcellular localization of Vangl2 varies depending on the cellular context and developmental stage. In Xenopus oocytes, Vangl2 exhibits a surprising distribution pattern, being located not at the plasma membrane but in radially arranged islands in the subcortical cytoplasm . These islands are particularly enriched in the animal hemisphere of the oocyte . This localization pattern is specific to endogenous Vangl2, as exogenously introduced Vangl2 mRNA produces protein that accumulates at the cell membrane rather than in these subcortical islands, suggesting differential processing mechanisms .

In embryonic tissues, Vangl2 and Vangl2-Long contribute to the pool of molecules present at the plasma membrane, where they maintain planar cell polarity in vertebrate tissues . The proper membrane localization of these proteins is essential for their function in establishing and maintaining cellular polarity.

Functional Roles and Interactions

Vangl2-a engages in multiple protein-protein interactions that are critical for its function in cellular polarity and embryonic development. Several key interaction partners have been identified through biochemical analyses.

Interaction with VAMP1

In Xenopus oocytes, Vangl2 interacts with VAMP1, a post-Golgi v-SNARE protein involved in vesicular trafficking . This interaction appears to be functionally significant, as Vangl2 is required for the stability of VAMP1 protein in the oocyte . The Vangl2-VAMP1 association suggests a role for Vangl2 in vesicle trafficking events, potentially regulating the secretion versus storage of various proteins .

Interaction with Atypical PKC

Vangl2 also interacts with atypical protein kinase C (aPKC), a component of the apical-basal polarity pathway . This interaction connects the planar cell polarity and apical-basal polarity pathways, suggesting a coordinated regulation of multiple aspects of cellular polarity . Both Vangl2 and aPKC are required for the maintenance of the acetylated microtubule cytoskeleton and the proper distribution of Vangl2-VAMP1 in the oocyte .

Cytoskeletal Interactions

In the Xenopus oocyte, Vangl2 interacts with acetylated microtubules and is required for maintaining the stable microtubule architecture . This connection to the cytoskeleton is likely important for the spatial organization of cellular components and for establishing and maintaining cellular asymmetries during development.

Role in Embryonic Development

Vangl2-a plays critical roles in various aspects of embryonic development, particularly in processes requiring the establishment and maintenance of cellular polarity.

Neural Tube Closure

Vangl2 is of major importance in embryonic development, as illustrated by its pivotal role during neural tube closure in human, mouse, Xenopus, and zebrafish . Both Vangl2 and Vangl2-Long isoforms are required for proper neural tube closure in Xenopus, as demonstrated by morpholino-mediated knockdown experiments . The failure of neural tube closure leads to neural tube defects, a common group of congenital malformations in humans.

Embryo Extension

Morpholino oligonucleotides designed to specifically knockdown Vangl2-Long in Xenopus have shown that this isoform is functional and required for embryo extension . This finding highlights the distinct contributions of the Vangl2-Long isoform to developmental processes and suggests that the N-terminal extension provides functional properties beyond those of canonical Vangl2.

Planar Cell Polarity

Both Vangl2 and Vangl2-Long must be correctly expressed for the polarized distribution of planar cell polarity molecules Pk2 and Dvl1 . They are also essential for centriole rotational polarity in ciliated epidermal cells . These requirements underscore the importance of Vangl2 isoforms in establishing and maintaining planar cell polarity, a fundamental property of many epithelial tissues.

Oocyte and Embryonic Asymmetry

Vangl2 and aPKC are required for the cell membrane asymmetry established during oocyte maturation . They are also necessary for the asymmetrical distribution of maternal transcripts for germ layer and dorsal/ventral determinants VegT and Wnt11 . These roles highlight the importance of Vangl2 in establishing the earliest asymmetries that guide subsequent embryonic development.

Clinical Significance

Vangl2 is the only planar cell polarity core component for which mutations have been identified in human familial and sporadic cases of neural tube defects . This clinical association underscores the critical importance of Vangl2 in human development and suggests that variations in Vangl2 function may contribute to a range of developmental disorders characterized by defects in cellular polarity and tissue organization.

Laboratory Applications and Handling

For research applications, recombinant Vangl2-a protein is typically provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . Recommended handling includes reconstitution in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For long-term storage, aliquoting with 5-50% glycerol (final concentration) and storing at -20°C to -80°C is advised, with repeated freeze-thaw cycles being discouraged .

Working aliquots can be stored at 4°C for up to one week . These handling recommendations ensure the stability and functionality of the recombinant protein for various experimental applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
vangl2-a; stbm-a; Vang-like protein 2-A; Protein strabismus-A; Van Gogh-like protein 2-A; Xstrabismus-A; Xstbm-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
vangl2-a
Target Protein Sequence
MDNDSQYSGYSYKSGHSRSSRKHRDRRERHRSKSREGSRGDKSVTIQAPGEPLLDNESTR GEDRDDNWGETTTVVTGTSEHSISHDDITRITKDMEDSAKLDCSRHLGVVIGGALALLSF LTPIAFMLLPQILWREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFV FRALLMVLVFLLVVSYWLFYGVRILESRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELR QLQPQFTIKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSK KMSGFKVYSLGEENTTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRKARLV VAVEEAFTHIKRLQDEDQKNPREIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LHHLEFCITHDMTPKAFLERYLGPGPTIQYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVL KRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV
Uniprot No.

Target Background

Function
Vangl2-A plays a role in non-canonical Wnt/planar cell polarity (PCP) signaling. It facilitates the recruitment of dvl/dsh and prickle from the cytoplasm to the plasma membrane. As part of a PCP complex, it regulates the polarized assembly of fibronectin on the mesoderm surface during gastrulation. Vangl2-A contributes to convergent extension cell movements in both dorsal mesoderm and neural tissue during gastrulation, without impacting cell fate. It also regulates neural fold closure during neurulation. Vangl2-A may be involved in the cell surface localization of fzd3 and fzd6 in the inner ear.
Database Links

KEGG: xla:398271

UniGene: Xl.10610

Protein Families
Vang family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
During gastrulation, broadly expressed throughout the marginal zone and animal cap region. From the neurula stages, expression becomes concentrated in neural tissues, in the neural plate and neural tube.

Q&A

What is Xenopus laevis Vang-like protein 2-A (vangl2-a) and what role does it play in development?

Xenopus laevis Vang-like protein 2-A (vangl2-a) is a transmembrane protein that functions as a core component of the planar cell polarity (PCP) signaling pathway. This pathway is essential for coordinating cell behaviors across tissue planes during embryonic development. Recent research has identified two distinct isoforms of this protein: the canonical Vangl2 (62 kDa) and an N-terminally extended variant called Vangl2-Long (70 kDa) .

The canonical Vangl2 isoform initiates from a conventional AUG start codon, while the longer Vangl2-Long isoform results from translation initiation at a near-cognate AUA start codon located 144 nucleotides upstream of the canonical start site . The N-terminal extension of Vangl2-Long comprises 53 amino acids in Xenopus, and this extension is highly conserved across vertebrate species but absent in invertebrates .

Both Vangl2 isoforms are critical for proper embryonic development in Xenopus, particularly for processes requiring coordinated cell movements such as convergent extension during gastrulation and neurulation, and for neural tube closure . Disruption of either isoform leads to characteristic PCP phenotypes, including shortened body axis and neural tube defects .

How can researchers detect and distinguish between Vangl2 and Vangl2-Long isoforms?

Researchers can employ several complementary approaches to detect and distinguish between the two Vangl2 isoforms:

Western Blotting: Both isoforms can be detected simultaneously using antibodies that recognize shared epitopes, such as monoclonal antibody 36E3, which reveals distinct bands at 62 kDa (Vangl2) and 70 kDa (Vangl2-Long) . For specific detection of Vangl2-Long, researchers can use antibodies raised against peptides within the N-terminal extension, such as N-VGL2 polyclonal antibodies .

Mass Spectrometry: This approach can provide definitive identification of isoform-specific peptides. In Xenopus embryos, mass spectrometry analysis of immunoprecipitated proteins has identified peptides corresponding to both the canonical N-terminus of Vangl2 and peptides containing the additional amino acids specific to the N-terminal extension of Vangl2-Long .

Immunofluorescence: The subcellular localization of each isoform can be visualized using GFP-tagged constructs or isoform-specific antibodies. While both isoforms localize to the plasma membrane, Vangl2-Long exhibits additional enrichment in the Golgi apparatus .

Expression Analysis: RT-PCR and quantitative PCR can be used to analyze the mRNA encoding both isoforms, though these methods cannot distinguish between the two proteins since they are encoded by the same transcript and differ only in translation initiation site usage .

What is the expression pattern of Vangl2 isoforms during Xenopus embryogenesis?

The expression of both Vangl2 and Vangl2-Long follows a precise developmental program during Xenopus embryogenesis, with distinct temporal regulation of each isoform:

Developmental StageVangl2 ExpressionVangl2-Long Expression
Cleavage (stage 1)Detectable (maternal)Detectable (maternal)
Midblastula transition (stages 8-9)IncreasingIncreasing
GastrulationHighHigh
NeurulationHighHigh
Tail bud (stage 25+)Remains highSignificant decline

Both isoforms are detectable from the earliest stages of embryogenesis (cleavage stages), likely from maternal origin . Following midblastula transition (stages 8-9), the expression of both isoforms increases, reaching peak levels during gastrulation and neurulation . While Vangl2 remains highly expressed from gastrulation through organogenesis, Vangl2-Long shows a significant decline in expression from tail bud stage 25 onward .

This differential regulation suggests that the alternative translation of Vangl2-Long is subject to precise developmental control, highlighting its specific role during critical periods of embryonic development .

How do the Vangl2 and Vangl2-Long isoforms differ in their molecular interactions and subcellular localization?

The two Vangl2 isoforms exhibit important differences in their molecular interactions and subcellular distribution that influence their functional roles:

Protein Complexes: Both Vangl2 and Vangl2-Long can form multimeric complexes with Vangl1 and with each other . Immunoprecipitation experiments have demonstrated that Vangl2-Long physically interacts with Vangl2 . Mass spectrometry analysis of proteins immunoprecipitated from Xenopus embryos has identified peptides corresponding to both Vangl2 isoforms as well as Vangl1, indicating that these proteins exist in heteromeric complexes in vivo .

Subcellular Localization: While both isoforms localize to the plasma membrane, Vangl2-Long shows distinctive enrichment in the Golgi apparatus . This differential localization is directly attributable to the N-terminal extension, as:

  • The N-terminal extension acts as a transferable signal that promotes protein accumulation in the Golgi when added to other proteins (e.g., Vangl1)

  • Mutations in conserved residues within the N-terminal extension (particularly V8 and L11) disrupt Golgi localization and cause increased accumulation at cell-cell contacts

Functional Distribution: The distinct localization patterns suggest that Vangl2-Long may play a regulatory role in Vangl2 trafficking between the Golgi apparatus and the plasma membrane . The extended retention time of Vangl2-Long in the Golgi could influence the processing, transport, or quality control of Vangl2 proteins before they reach the cell surface .

What experimental approaches can be used to specifically target Vangl2-Long expression in Xenopus embryos?

Researchers can employ several strategies to specifically target Vangl2-Long expression in Xenopus embryos:

Morpholino Oligonucleotides (MOs): Antisense MOs can be designed to specifically block translation of Vangl2-Long by targeting the region containing the alternative translation initiation site . This approach allows researchers to inhibit Vangl2-Long expression without affecting canonical Vangl2 . When designing such MOs:

  • The MO should target the region containing the near-cognate AUA start codon located upstream of the canonical AUG start codon

  • Control MOs with mismatched sequences should be included to verify specificity

  • Rescue experiments using Vangl2-Long mRNA resistant to the MO should be performed to confirm phenotype specificity

CRISPR/Cas9 Gene Editing: Precise mutations can be introduced to disrupt the alternative translation initiation site or key residues in the N-terminal extension. This approach requires careful design to avoid affecting the canonical Vangl2 isoform.

Site-directed Mutagenesis: Mutations of conserved residues in the N-terminal extension (such as V8A and L11A) can be introduced to disrupt the function of Vangl2-Long without eliminating its expression . This approach is particularly useful for studying the functional significance of specific domains or residues within the extension.

Validation Methods: Researchers should confirm isoform-specific knockdown by:

  • Western blotting using antibodies that detect both isoforms to verify selective reduction of Vangl2-Long

  • Immunofluorescence to assess changes in subcellular localization

  • Phenotypic analysis focusing on PCP-related defects such as neural tube closure and convergent extension movements

What phenotypes result from specific disruption of Vangl2-Long in Xenopus embryos?

Specific disruption of Vangl2-Long in Xenopus embryos using morpholino oligonucleotides results in characteristic PCP-related phenotypes:

Neural Tube Closure Defects: Knockdown of Vangl2-Long leads to failure of neural tube closure, a hallmark phenotype of PCP dysfunction . This indicates that both Vangl2 isoforms must be correctly expressed for proper neural tube morphogenesis.

Convergent Extension Defects: Embryos with reduced Vangl2-Long expression exhibit impaired convergent extension movements during gastrulation and neurulation, resulting in a shortened body axis . This phenotype reflects the critical role of PCP signaling in coordinating cell intercalation movements.

Disrupted PCP Molecule Distribution: In Vangl2-Long-depleted embryos, the polarized distribution of other PCP components is perturbed, including Prickle 2 (Pk2) and Dishevelled 1 (Dvl1) . This indicates that Vangl2-Long is required for establishing or maintaining the asymmetric localization of PCP molecules.

Centriole Rotational Polarity Defects: Knockdown of Vangl2-Long disrupts centriole rotational polarity in ciliated epidermal cells . This demonstrates that Vangl2-Long contributes to the establishment of cellular polarity beyond convergent extension movements.

These phenotypes underscore the essential and non-redundant function of Vangl2-Long in establishing PCP during vertebrate embryogenesis, despite its lower expression level compared to canonical Vangl2 .

How does the N-terminal extension of Vangl2-Long influence protein function and localization?

The N-terminal extension of Vangl2-Long plays crucial roles in determining protein function and localization:

Golgi Apparatus Targeting: The N-terminal extension acts as a signal that promotes accumulation of Vangl2-Long in the Golgi apparatus . This localization pattern likely results from an extended retention time in this organelle compared to canonical Vangl2.

Transferable Localization Signal: When the N-terminal extension is added to Vangl1 (creating a chimeric Vangl1-Long protein), it confers Golgi localization to this protein as well . This demonstrates that the extension functions as a transferable signal that can influence the trafficking of diverse proteins.

Conserved Functional Residues: Within the N-terminal extension, certain hydrophobic residues are strictly conserved across vertebrate species and play critical roles in protein localization:

  • Mutation of the conserved V8 residue to alanine (V8A) causes partial relocalization of Vangl2-Long from the Golgi to cell-cell contacts

  • Mutation of L11 to alanine (L11A) or the double mutation (V8A L11A) results in more severe mislocalization, with dramatic accumulation at E-cadherin-containing cell-cell contacts and significant reduction in Golgi localization

Evolutionary Conservation: The N-terminal extension is found exclusively in vertebrate Vangl2 sequences and is absent in invertebrates and in Vangl1 paralogs . This strict conservation pattern suggests that the extension emerged as a vertebrate-specific adaptation that confers additional regulatory capability to Vangl2 function.

The N-terminal extension likely evolved to provide an additional layer of regulation to Vangl2 trafficking and function, possibly contributing to the increased complexity of PCP signaling required for vertebrate development .

What are the key experimental controls needed when studying Vangl2 isoforms in Xenopus?

When investigating Vangl2 isoforms in Xenopus, researchers should implement several critical experimental controls:

Antibody Validation:

  • Verify antibody specificity using overexpression systems with tagged versions of both Vangl2 and Vangl2-Long

  • Include appropriate negative controls (e.g., immunoprecipitation with control antibodies)

  • Confirm that isoform-specific antibodies (such as those targeting the N-terminal extension) do not cross-react with other proteins

Morpholino Controls:

  • Include standard control morpholinos to account for non-specific effects

  • Perform dose-response experiments to determine optimal morpholino concentrations

  • Conduct rescue experiments using morpholino-resistant mRNAs to confirm specificity

  • Verify knockdown efficiency by Western blotting using antibodies that detect both isoforms

Expression Constructs:

  • For functional studies, use constructs that express only one isoform (e.g., by mutating the alternative start codon)

  • Include appropriate tags (e.g., GFP, FLAG) that don't interfere with protein function

  • Verify expression levels to avoid artifacts from overexpression

Localization Studies:

  • Include co-localization markers for subcellular compartments (e.g., GM130 for Golgi apparatus, E-cadherin for cell-cell contacts)

  • Perform quantitative co-localization analysis

  • Compare wild-type proteins with mutant versions (e.g., V8A, L11A) to identify functional domains

Developmental Stage Selection:

  • Choose appropriate developmental stages based on the known expression patterns of both isoforms

  • Account for the differential regulation of Vangl2 and Vangl2-Long during development

How can researchers resolve contradictory findings about Vangl2 function across different model systems?

Resolving contradictory findings about Vangl2 function across different model systems requires systematic approaches:

Isoform-Specific Analysis: Many contradictions may arise from failing to distinguish between Vangl2 and Vangl2-Long. Researchers should:

  • Explicitly determine which isoform(s) are being targeted in each experimental system

  • Use isoform-specific reagents (antibodies, morpholinos) when possible

  • Consider the relative expression levels of each isoform in different tissues or developmental stages

Comparative Studies:

  • Conduct parallel experiments in multiple model systems using identical reagents and protocols

  • Create a comparative table of Vangl2 isoform characteristics across species:

SpeciesVangl2 SizeVangl2-Long SizeN-terminal Extension LengthKey Conserved Residues
Human62 kDa70 kDa48 aaV8, L11 and others
Mouse62 kDa70 kDa48 aaV8, L11 and others
Xenopus62 kDa70 kDa53 aaV8, L11 and others

Context-Dependent Functions:

  • Evaluate whether contradictions reflect genuine biological differences between systems

  • Consider tissue-specific functions, developmental timing, or compensatory mechanisms

  • Assess the presence and role of interacting partners (e.g., Vangl1) in each system

Technical Considerations:

  • Standardize experimental conditions and analytical methods

  • Use multiple complementary approaches to address the same question

  • Employ CRISPR/Cas9 technology to generate consistent mutations across model systems

Reconciliation Strategies:

  • Develop unified models that incorporate differences as context-dependent variations

  • Consider evolutionary aspects that might explain functional divergence

  • Focus on conserved mechanisms while acknowledging species-specific adaptations

What techniques are most effective for analyzing Vangl2 protein complexes in Xenopus tissues?

Several complementary techniques are particularly effective for analyzing Vangl2 protein complexes in Xenopus tissues:

Co-immunoprecipitation (Co-IP):

  • Use antibodies that recognize endogenous proteins (e.g., mAb 36E3 for Vangl2 isoforms)

  • Combine with Western blotting to identify interacting partners

  • This approach has successfully demonstrated interactions between Vangl2, Vangl2-Long, and Vangl1 in Xenopus embryos

Mass Spectrometry:

  • Apply to immunoprecipitated complexes to identify novel interaction partners

  • Can detect isoform-specific peptides to confirm the presence of both Vangl2 and Vangl2-Long

  • Has been successfully used to identify peptides unique to the N-terminal extension of Vangl2-Long in Xenopus

Proximity Labeling:

  • Fuse BioID or APEX2 to Vangl2 isoforms to identify proteins in close proximity in vivo

  • Particularly useful for identifying transient or weak interactions in native cellular contexts

Fluorescence Resonance Energy Transfer (FRET):

  • Tag Vangl2 isoforms and potential interaction partners with appropriate fluorophores

  • Enables detection of protein-protein interactions in live Xenopus embryos or cells

  • Can reveal spatial and temporal dynamics of interactions

Bi-molecular Fluorescence Complementation (BiFC):

  • Split fluorescent protein fragments are fused to potential interaction partners

  • Reconstitution of fluorescence indicates protein-protein interaction

  • Allows visualization of interaction sites within cells

Cross-linking Mass Spectrometry:

  • Chemical cross-linking stabilizes protein complexes before analysis

  • Enables identification of interaction interfaces at amino acid resolution

  • Particularly valuable for membrane protein complexes like those containing Vangl2

For optimal results, researchers should implement multiple complementary approaches and include appropriate controls to validate interactions. When analyzing results, it's important to consider the developmental stage of the Xenopus embryos, as the composition of Vangl2 complexes may change during development in accordance with the differential expression patterns of Vangl2 and Vangl2-Long .

What are the critical unanswered questions regarding Vangl2-Long function in Xenopus development?

Several critical questions remain unanswered regarding Vangl2-Long function in Xenopus development:

Regulatory Mechanisms:

  • How is alternative translation initiation at the near-cognate AUA start codon regulated during development?

  • What factors determine the ratio of Vangl2 to Vangl2-Long expression in different tissues and developmental stages?

  • What mechanisms control the decline in Vangl2-Long expression from tail bud stage 25 onward?

Functional Significance of Golgi Localization:

  • What is the precise function of Vangl2-Long in the Golgi apparatus?

  • Does Vangl2-Long regulate the trafficking or processing of canonical Vangl2 or other PCP components?

  • How does the Golgi pool of Vangl2-Long communicate with the plasma membrane pool?

Isoform-Specific Protein Interactions:

  • Do Vangl2 and Vangl2-Long interact with different sets of proteins?

  • Are there proteins that specifically recognize the N-terminal extension?

  • How do heteromeric complexes containing both isoforms differ functionally from homomeric complexes?

Tissue-Specific Functions:

  • Are there tissues or cell types where Vangl2-Long plays a more prominent role than canonical Vangl2?

  • Do the two isoforms contribute differently to distinct PCP-dependent processes?

Signaling Integration:

  • How does Vangl2-Long influence cross-talk between PCP and other signaling pathways?

  • Does the N-terminal extension provide additional regulatory inputs from other signaling systems?

Evolution and Conservation:

  • Why is the N-terminal extension present only in vertebrate Vangl2 and not in Vangl1 or invertebrate homologs?

  • What selection pressures drove the conservation of specific residues like V8 and L11 across vertebrate evolution?

Addressing these questions will require sophisticated approaches combining isoform-specific manipulations, live imaging of protein dynamics, and systems biology approaches to understand the complex regulation and function of Vangl2 isoforms in vertebrate development.

What advanced imaging techniques can resolve subcellular dynamics of Vangl2 isoforms in Xenopus embryos?

Advanced imaging techniques that can resolve the subcellular dynamics of Vangl2 isoforms in Xenopus embryos include:

Super-Resolution Microscopy:

  • Structured Illumination Microscopy (SIM): Provides ~100 nm resolution, suitable for visualizing protein distribution at the plasma membrane and in the Golgi

  • Stimulated Emission Depletion (STED): Offers resolution down to ~30-50 nm, enabling detailed analysis of Vangl2 clustering and organization

  • Photoactivated Localization Microscopy (PALM)/Stochastic Optical Reconstruction Microscopy (STORM): Achieves ~20 nm resolution for precise localization of individual Vangl2 molecules

Live Imaging Approaches:

  • Fluorescence Recovery After Photobleaching (FRAP): Measures protein mobility and exchange rates between different subcellular pools

  • Fluorescence Loss In Photobleaching (FLIP): Assesses continuity and communication between different protein populations

  • Photoactivation/Photoconversion: Tracks specific subpopulations of Vangl2 isoforms over time to monitor trafficking routes

Multi-Color Imaging:

  • Simultaneous visualization of both Vangl2 isoforms using differentially tagged proteins

  • Co-imaging with markers for specific subcellular compartments (Golgi, endosomes, plasma membrane domains)

  • Correlation with other PCP components to assess co-localization and co-trafficking

Light Sheet Microscopy:

  • Enables long-term imaging with minimal phototoxicity

  • Suitable for tracking Vangl2 dynamics throughout developmental processes

  • Can be combined with tissue clearing techniques for deep imaging

Quantitative Approaches:

  • Fluorescence Correlation Spectroscopy (FCS): Measures diffusion rates and molecular concentrations

  • Number and Brightness Analysis: Determines the oligomeric state of protein complexes

  • Raster Image Correlation Spectroscopy (RICS): Analyzes protein diffusion and interactions

When implementing these techniques, researchers should consider:

  • Using knock-in approaches to tag endogenous proteins when possible

  • Validating that fluorescent tags do not disrupt protein function or localization

  • Developing quantitative analysis pipelines to extract meaningful parameters from imaging data

  • Combining imaging with perturbation approaches (e.g., isoform-specific knockdown) to assess functional consequences

These advanced imaging approaches will help reveal how the differential localization and trafficking of Vangl2 isoforms contribute to their distinct functions in establishing and maintaining planar cell polarity during Xenopus development.

What are the optimal conditions for expressing and purifying recombinant Xenopus laevis Vangl2-a for structural studies?

For expressing and purifying recombinant Xenopus laevis Vangl2-a for structural studies, researchers should consider the following protocol:

Expression System Selection:

  • Mammalian expression systems (HEK293, CHO) are often preferred for membrane proteins requiring post-translational modifications

  • Insect cell systems (Sf9, High Five) offer good compromise between yield and proper folding

  • E. coli systems may be suitable for soluble domains but challenging for full-length transmembrane proteins

Construct Design:

  • Create separate constructs for Vangl2 and Vangl2-Long to compare their properties

  • Include purification tags (His6, FLAG, etc.) that can be cleaved by specific proteases

  • Consider fusion proteins (e.g., MBP, SUMO) to enhance solubility

  • For structural studies of specific domains, design constructs containing only those regions

  • Remove potential flexible regions that might hinder crystallization

Expression Optimization:

  • Test multiple expression conditions (temperature, induction time, inducer concentration)

  • For mammalian/insect cells, optimize virus titer or transfection conditions

  • Consider addition of chemical chaperones to improve folding

  • Implement stable cell lines for consistent high-level expression

Membrane Protein Extraction:

  • Screen detergents for optimal extraction efficiency and protein stability:

    • Mild detergents (DDM, LMNG, GDN) often preserve protein structure

    • Test detergent concentrations and extraction times

  • Consider native nanodiscs or SMALPs for detergent-free extraction

  • Perform extraction at 4°C with protease inhibitors to prevent degradation

Purification Strategy:

  • Affinity chromatography (IMAC, anti-FLAG) as initial capture step

  • Size exclusion chromatography to remove aggregates and assess homogeneity

  • Ion exchange chromatography for further purification if needed

  • Consider lipid supplementation during purification to maintain protein stability

Quality Control Assessments:

  • SDS-PAGE and Western blotting to confirm identity and purity

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state

  • Thermal stability assays to optimize buffer conditions

  • Negative stain electron microscopy to check sample homogeneity

Structural Analysis Methods:

  • X-ray crystallography: Requires highly pure, homogeneous, and stable protein preparations

  • Cryo-electron microscopy: Increasingly viable for membrane proteins in various membrane mimetics

  • Nuclear magnetic resonance (NMR): Suitable for specific domains rather than full-length protein

By systematically optimizing each step of this process, researchers can produce high-quality recombinant Xenopus Vangl2-a suitable for detailed structural studies, which will provide valuable insights into how the N-terminal extension influences protein conformation and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.