Recombinant Xenopus laevis Vezatin (vezt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Vezatin (Vezt)

Recombinant Xenopus laevis Vezatin (Vezt) is a protein derived from the African clawed frog, Xenopus laevis. This protein is expressed in Escherichia coli and is tagged with a His-tag for easy purification and identification. Vezatin is known to be involved in cellular adhesion processes, particularly at adherens junctions, where it interacts with myosin VIIA .

Characteristics of Recombinant Xenopus laevis Vezatin (Vezt)

The recombinant full-length Xenopus laevis Vezatin protein is characterized by its amino acid sequence spanning from 1 to 774 amino acids. It is provided in a lyophilized powder form with a purity of greater than 90% as determined by SDS-PAGE. The storage buffer is Tris/PBS-based with 6% trehalose at pH 8.0 .

Potential Applications:

  • Cellular Adhesion Studies: Understanding how Vezatin interacts with other proteins at adherens junctions can provide insights into cellular adhesion mechanisms.

  • Developmental Biology: Given Xenopus laevis' role as a model organism, Vezatin could be used to study developmental processes, especially those involving cell-cell interactions.

Expression and Purification

The recombinant Vezatin protein is expressed in E. coli, which allows for efficient production and purification using the His-tag. This method is common for producing recombinant proteins for research purposes .

Expression and Purification Steps:

  1. Expression in E. coli: The gene encoding Vezatin is inserted into an expression vector and transformed into E. coli cells.

  2. Induction of Expression: The bacteria are induced to express the protein.

  3. Purification: The His-tagged protein is purified using affinity chromatography.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
vezt; Vezatin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-774
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
vezt
Target Protein Sequence
MTAEFDEEVVFENSPLFQYLQDLGHTDFEICPLSKEEERLAENGQGKQDVHTTEKKSIIS RTVEFLKSWSPFLSKKKKDEKIHLLEIGFRLESLRTILQQEVLIQEDVELIELLDPGILS AGQTQNQQNDHLPTLWSIATPNIWETSILFVFLSAVAAFQSWSISSSLIWGPSLILFAAF TVLKTLHTWRSARLRIILRKYCTQVEGTVSNSRAFTNLVRKALRLIQETEVISRGFTLVS AACPYGKAGQHASQHLLGLRKAVYRTVRTNFRISRLATLYMLKHYPLNSEIDNVTNYICV VPLKDLGLGLCEEHVSEEDAHNLTDAFSLPALKVLFQLWIGQSSEFFRRLALLLSPENAS QGPSTSPEQLPHFIWSDVVQDLPHTQAACMAELKRSYEFYRYFETQHQSGLERTAKRKEV GELNNLHGAVRSLQLHLKALLNEVIVLEDELDKLSSCKEMQAVTPEASLMLEEKLRIIQP HVQASNTCWEEALCQVERMVRKPTTKKDTGKYSCENLNYPVVSNVPPAMRIEDRDPVPEE QILEAYVEEAVTDQEFNSEEIYLFSPEERERQKREREESRRVLQELKAVLGLKASEAERQ KWKQLLFSEHAVITPLLPEEPVGHFEPLLSIYPEEPHKNLGFYGEIPSEINGTEHVKDAP IQVDHGNMNHEDEAKICPVSEEVEPASCKEEEDETPCPAPRTVLPPAIKERLARIHQSSD LNFTSGLATQVAARSLTFTFLQEQTFGDEWDDDDDNEDHDHDKERNNDSSQLEG
Uniprot No.

Target Background

Function
Vezatin plays a crucial role in the formation and maintenance of adherens junctions throughout life.
Database Links

KEGG: xla:398809

UniGene: Xl.9787

Protein Families
Vezatin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, adherens junction. Nucleus.

Q&A

What is Xenopus laevis Vezatin and what is its primary function in development?

Xenopus laevis Vezatin (vezt) is a transmembrane protein involved in cell adhesion and morphogenetic processes during embryonic development. The full-length protein consists of 774 amino acids and contains multiple domains that facilitate its interactions with cytoskeletal elements. The recombinant form is typically expressed with an N-terminal His tag in E. coli expression systems, allowing for easier purification and detection in experimental settings .

The protein's function appears to be associated with cellular organization and potentially with the cytokeratin network that plays crucial roles in early Xenopus development. Similar to other structural RNAs and proteins in Xenopus, Vezatin may participate in maintaining cellular architecture during the critical stages of embryogenesis, particularly as the embryo transitions from maternal to zygotic control of development .

Why is Xenopus laevis an advantageous model for studying Vezatin protein?

Xenopus laevis offers several distinct advantages as a model organism for studying proteins like Vezatin. The large, abundant eggs and readily manipulable embryos make it ideal for investigating protein function during development. A single female can produce up to 4,000 eggs per spawning, providing large batches of synchronous sibling embryos that develop externally . This allows for high-throughput experimental approaches and statistical power in protein expression studies.

The embryonic development is relatively rapid, with most major organs forming within 5 days following fertilization, and the transparency of tissues surrounding major viscera during this timeframe allows for easy observation of developmental processes . These characteristics make Xenopus particularly useful for studying proteins involved in morphogenesis and cellular organization, such as Vezatin.

Additionally, the rich history of Xenopus as a model for developmental biology has generated abundant tools and techniques specifically optimized for protein research in this system, including well-established protocols for microinjection of materials and microsurgery .

How is Recombinant Xenopus laevis Vezatin typically expressed and purified for research use?

Recombinant Xenopus laevis Vezatin expression typically utilizes E. coli expression systems with N-terminal His-tag fusion to facilitate purification . The expression construct contains the full-length protein sequence (amino acids 1-774) of Xenopus laevis Vezatin with the UniProt accession number Q6PCG6.

For purification, the following methodological approach is recommended:

  • Express the His-tagged protein in an appropriate E. coli strain under optimized conditions

  • Harvest cells and lyse using appropriate buffer systems

  • Purify using immobilized metal affinity chromatography (IMAC), taking advantage of the His-tag

  • Perform quality control assessments including SDS-PAGE to confirm purity (>90% purity is typical)

  • Lyophilize the purified protein for storage stability

The recommended reconstitution protocol involves briefly centrifuging the vial prior to opening, then reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, adding glycerol to a final concentration of 5-50% and aliquoting for storage at -20°C/-80°C is advised to prevent damage from freeze-thaw cycles .

What experimental approaches are most effective for studying Vezatin function in Xenopus embryos?

For investigating Vezatin function in Xenopus embryos, several complementary experimental approaches are recommended:

Gain-of-function studies:
Xenopus laevis has traditionally been used for gain-of-function experiments through mRNA injection into embryos . For Vezatin studies, synthesize capped mRNA encoding full-length Vezatin and microinject into one-cell or two-cell stage embryos. This approach allows for overexpression and assessment of phenotypic consequences. When injecting 1 ng of capped mRNA (similar to protocols used for Xcdc6 studies), ensure proper controls using equivalent volumes of H₂O .

Loss-of-function studies:
While traditional mutagenesis approaches have been limited in Xenopus laevis due to its allotetraploid genome, several methods can be employed:

  • Morpholino antisense oligonucleotides targeting Vezatin mRNA

  • Dominant-negative constructs (a historically successful approach in Xenopus)

  • CRISPR/Cas9 system adapted for Xenopus

  • Consider using Xenopus tropicalis as a complementary model for genetic manipulation

Protein localization studies:
To determine the subcellular localization of Vezatin:

  • Generate GFP-tagged versions of Vezatin for live imaging

  • Perform immunofluorescence using antibodies against the His-tag or Vezatin itself

  • Analyze potential co-localization with cytoskeletal elements or adherens junction components

Protein interaction studies:

  • Co-immunoprecipitation with potential binding partners

  • Proximity ligation assays in fixed embryonic tissues

  • Yeast two-hybrid screens using Vezatin domains as bait

These approaches should be integrated with developmental timing analyses, as protein expression dynamics change significantly during early Xenopus development, particularly around the mid-blastula transition (MBT) when the embryo transitions from maternal to zygotic control .

How can I investigate Vezatin protein-protein interactions in Xenopus laevis developmental contexts?

Investigating Vezatin protein-protein interactions in Xenopus development requires a multi-faceted approach:

Co-immunoprecipitation from embryonic lysates:

  • Collect embryos at specific developmental stages (pre-MBT, post-MBT, gastrulation)

  • Prepare lysates using buffers that preserve protein-protein interactions

  • Immunoprecipitate using anti-Vezatin antibodies or anti-His antibodies for the recombinant protein

  • Analyze co-precipitating proteins by mass spectrometry

  • Validate key interactions with Western blot analysis

Proximity-based approaches:

  • BioID or TurboID fusion constructs with Vezatin to identify proximal proteins in living embryos

  • APEX2 proximity labeling to identify interactions in specific subcellular compartments

Quantitative proteomics for temporal dynamics:
Xenopus provides an excellent system for quantitative proteomics across developmental stages. Similar to the approach used in comprehensive proteomics studies, iTRAQ isotopic labeling and mass spectrometry can be employed to identify changes in Vezatin-interacting proteins across developmental stages . This approach has successfully identified expression dynamics of nearly 4,000 proteins in Xenopus laevis from fertilized egg to neurula embryo.

Functional validation of interactions:

  • Co-express Vezatin with candidate interacting proteins and assess phenotypic consequences

  • Design mutants in specific domains of Vezatin to disrupt individual interactions

  • Use reporter systems for relevant signaling pathways that might be affected by Vezatin interactions

For example, if Vezatin is hypothesized to interact with cytoskeletal components based on structural predictions, co-localization studies with markers for the cytokeratin network would be informative, especially given the importance of this network in early Xenopus development and its dependence on certain RNA-protein interactions .

What are the methodological challenges in performing Vezatin loss-of-function studies in Xenopus laevis?

Loss-of-function studies for Vezatin in Xenopus laevis face several methodological challenges that require careful experimental design:

Genome duplication challenges:
Xenopus laevis is allotetraploid, meaning it has undergone genome duplication during evolution, potentially resulting in multiple gene copies with redundant functions . This redundancy can mask phenotypes in single-gene knockdown experiments. To address this:

  • Design knockdown reagents that target all relevant paralogs

  • Verify knockdown efficiency for each paralog using qPCR or Western blotting

  • Consider using Xenopus tropicalis as a complementary diploid model for cleaner genetic manipulations

Temporal regulation challenges:
If Vezatin has critical early developmental roles, complete loss-of-function may cause early lethality, masking later functions:

  • Use inducible systems to control timing of knockdown (e.g., temperature-sensitive constructs)

  • Employ tissue-specific promoters for localized manipulation

  • Generate chimeric embryos through transplantation experiments

Technical delivery challenges:

  • Optimize microinjection techniques for even distribution of knockdown reagents

  • For morpholinos or CRISPR components, determine optimal concentration ranges that balance efficiency and toxicity

  • Include lineage tracers to follow cells that have received the knockdown components

Validation challenges:
To confirm specificity of phenotypes and avoid off-target effects:

  • Use multiple independent knockdown approaches (morpholinos targeting different regions, CRISPR/Cas9)

  • Perform rescue experiments with morpholino/CRISPR-resistant mRNA constructs

  • Include appropriate controls for each technique (e.g., standard control morpholinos)

Given the success of dominant negative approaches in Xenopus for other proteins , designing dominant negative versions of Vezatin may be particularly effective, especially if structure-function relationships of specific domains can be exploited.

How can I design experiments to study the potential role of Vezatin in cytoskeletal organization during Xenopus development?

Designing experiments to study Vezatin's role in cytoskeletal organization requires multiple complementary approaches:

Live imaging of cytoskeletal dynamics:

  • Generate transgenic Xenopus lines expressing fluorescent cytoskeletal markers (e.g., LifeAct-GFP for F-actin, EB3-GFP for microtubules)

  • Co-express these markers with wild-type or mutant forms of Vezatin

  • Perform high-resolution time-lapse microscopy of developing embryos

  • Quantify parameters such as cytoskeletal network density, dynamics, and organization

Mechanical perturbation experiments:
Xenopus embryos are excellent models for mechanical stress studies . To assess Vezatin's role in cytoskeletal response to mechanical forces:

  • Apply controlled mechanical strain to embryonic tissues (as described in search result )

  • Compare cytoskeletal reorganization in control versus Vezatin-depleted tissues

  • Analyze whether Vezatin is required for proper cytoskeletal alignment under stress

Subcellular localization during morphogenetic events:

  • Perform immunofluorescence for Vezatin and cytoskeletal markers during key morphogenetic processes (e.g., gastrulation, neurulation)

  • Focus on tissues undergoing active shape changes and cell movements

  • Assess co-localization with specific cytoskeletal structures at cell junctions and cortical regions

Biochemical fractionation approaches:

  • Perform subcellular fractionation of embryonic tissues to isolate cytoskeletal components

  • Analyze Vezatin distribution across fractions using Western blotting

  • Compare with known cytoskeletal proteins and junction components

Manipulation of cytoskeletal dynamics:

  • Treat embryos with cytoskeleton-disrupting drugs (e.g., cytochalasin D for actin, nocodazole for microtubules)

  • Assess how these treatments affect Vezatin localization and function

  • Determine if Vezatin overexpression can rescue or exacerbate cytoskeletal defects

Similar to studies on the role of mRNAs in maintaining the cytokeratin network in the vegetal cortex , it would be valuable to determine if Vezatin protein plays structural roles in organizing specific cytoskeletal elements during development, potentially in conjunction with other structural proteins.

What approaches can be used to study Vezatin expression dynamics during Xenopus development?

To comprehensively characterize Vezatin expression dynamics during Xenopus development, several complementary methodologies are recommended:

Quantitative proteomics:
Following the approach used in comprehensive developmental proteomics studies , implement iTRAQ isotopic labeling and mass spectrometry to measure Vezatin protein levels across developmental stages:

  • Collect embryos at multiple developmental timepoints (fertilized egg through neurula stages)

  • Process samples for proteomics analysis

  • Quantify Vezatin levels relative to reference proteins

  • Generate expression profiles across developmental stages

Western blot temporal analysis:

  • Collect embryos at defined stages (pre-MBT, MBT, gastrulation, neurulation, organogenesis)

  • Prepare protein extracts using standardized protocols

  • Perform Western blot analysis using antibodies specific to Xenopus Vezatin or the His-tag of the recombinant protein

  • Quantify band intensities and normalize to loading controls

  • Create temporal expression profiles similar to those generated for other developmental proteins

Immunohistochemistry and in situ hybridization:

  • Perform whole-mount immunostaining using Vezatin-specific antibodies at various developmental stages

  • Combine with in situ hybridization to correlate protein and mRNA expression patterns

  • Section stained embryos to assess tissue-specific expression patterns

  • Use confocal microscopy for detailed subcellular localization

Single-embryo protein heterogeneity analysis:
Similar to the approach used in comprehensive proteomics studies , analyze protein expression in single embryos to assess embryo-to-embryo variation:

  • Process individual embryos at the same developmental stage for protein extraction

  • Quantify Vezatin levels using sensitive detection methods

  • Assess the degree of heterogeneity between embryos

  • Compare to known patterns of protein heterogeneity during development

This multi-method approach will provide a comprehensive view of how Vezatin expression changes throughout development, potentially revealing stage-specific functions and regulatory mechanisms. The data can be presented in expression profile graphs similar to those generated for other developmental proteins in Xenopus, showing the dynamic changes that occur particularly around the mid-blastula transition when embryos shift from maternal to zygotic control .

What are the optimal storage conditions for maintaining activity of Recombinant Xenopus laevis Vezatin?

Proper storage of Recombinant Xenopus laevis Vezatin is critical for maintaining its structural integrity and biological activity. Based on established protocols for similar recombinant proteins, the following methodological approaches are recommended:

Short-term storage (up to one week):

  • Store working aliquots at 4°C

  • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 as a storage buffer

  • Avoid repeated freeze-thaw cycles which can lead to protein denaturation and aggregation

Long-term storage:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 5-50% (50% is recommended as the default)

  • Prepare small aliquots to minimize freeze-thaw cycles

  • Clearly label aliquots with protein concentration, date prepared, and buffer composition

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Allow complete dissolution before using in experiments

  • Verify protein integrity after reconstitution using techniques such as SDS-PAGE

Quality control checks:

  • Periodically assess protein activity after extended storage

  • Monitor for signs of degradation or aggregation

  • For critical experiments, use fresh or recently thawed aliquots

Adherence to these storage guidelines will help maintain protein stability and ensure consistent experimental results. Repeated freeze-thaw cycles should be strictly avoided as they significantly impact protein structure and function .

How can I troubleshoot protein aggregation issues when working with Recombinant Xenopus laevis Vezatin?

Protein aggregation is a common challenge when working with recombinant proteins like Xenopus laevis Vezatin. The following methodological approaches can help troubleshoot and prevent aggregation:

Prevention strategies:

  • Optimize buffer conditions:

    • Test different pH ranges (typically 7.0-8.5)

    • Include stabilizing agents such as trehalose (6% is recommended in storage buffer)

    • Add low concentrations of non-ionic detergents (0.01-0.05% Tween-20) for proteins with hydrophobic regions

  • Temperature management:

    • Keep protein samples cold during handling

    • Avoid rapid temperature changes

    • Thaw frozen aliquots slowly on ice

  • Concentration considerations:

    • Maintain protein at moderate concentrations (0.1-1.0 mg/mL as recommended)

    • For higher concentration needs, test incremental concentration to find aggregation threshold

Analytical methods to detect aggregation:

  • Visual inspection for cloudiness or visible precipitates

  • Dynamic light scattering (DLS) to detect formation of higher molecular weight species

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Native PAGE to assess native state integrity

Rescue strategies for aggregated samples:

  • Filtration through 0.22 μm filters to remove large aggregates

  • Gentle centrifugation (10,000 × g for 10 minutes) to pellet insoluble material

  • Addition of solubilizing agents compatible with downstream applications

  • For severe aggregation, consider fresh reconstitution from lyophilized stock

Experimental adaptation:

  • If aggregation consistently occurs under specific conditions, design experiments to accommodate this limitation

  • Consider using the protein immediately after reconstitution when aggregation is problematic

  • Test different fusion constructs or expression systems if persistent aggregation occurs

These troubleshooting approaches should be systematically documented to establish optimal handling conditions for each specific experimental application of Recombinant Xenopus laevis Vezatin.

What controls should be included when analyzing Vezatin function in Xenopus embryonic development?

When analyzing Vezatin function in Xenopus embryonic development, rigorous experimental controls are essential to ensure valid interpretations. The following controls should be systematically incorporated:

For gain-of-function experiments:

  • Vehicle control: Inject equivalent volumes of H₂O or buffer used to dilute the mRNA/protein

  • Dose-response series: Test multiple concentrations of Vezatin mRNA/protein to distinguish physiological from overexpression artifacts

  • Inactive mutant control: Express a non-functional Vezatin mutant at equivalent levels

  • Lineage tracer: Include fluorescent or enzymatic tracers to identify injected cells/tissues

  • Developmental stage control: Ensure precise staging of embryos according to Nieuwkoop and Faber criteria

For loss-of-function experiments:

  • Standard control morpholinos or non-targeting CRISPR guide RNAs

  • Multiple independent knockdown reagents targeting different regions

  • Rescue experiments with morpholino/CRISPR-resistant constructs

  • Partial knockdown series to identify dose-dependent effects

  • Specificity controls to rule out off-target effects

For phenotypic analysis:

  • Include positive controls known to produce similar phenotypes

  • Analyze multiple embryos (n ≥ 20 per condition) from different egg batches

  • Blind scoring of phenotypes to prevent observer bias

  • Quantitative metrics rather than subjective assessments when possible

  • Statistical analysis appropriate to the experimental design

For biochemical assays:

  • Positive and negative controls for Western blotting and immunoprecipitation

  • Recombinant protein standards for quantification

  • Loading controls appropriate for the developmental stages being analyzed

  • Time course controls to distinguish transient from sustained effects

For cytoskeletal interaction studies:

  • Known cytoskeletal-interacting proteins as positive controls

  • Cytoskeleton-disrupting drug treatments as functional controls

  • Fixation and staining controls to rule out artifacts

How can I optimize microinjection of Recombinant Xenopus laevis Vezatin protein for in vivo functional studies?

Optimizing microinjection of Recombinant Xenopus laevis Vezatin protein requires careful consideration of multiple parameters to ensure consistent delivery while maintaining embryo viability:

Protein preparation:

  • Reconstitute lyophilized Vezatin protein in a physiologically compatible buffer

  • Filter sterilize using 0.22 μm filters to remove particulates

  • Adjust protein concentration (typically 0.1-1.0 mg/mL range)

  • Include a small amount of inert tracking dye (e.g., Fast Green FCF at 0.05%) to visualize injection

  • Maintain protein on ice during the entire injection session

Needle preparation:

  • Pull glass needles with consistent tip diameters (10-15 μm for early embryos)

  • Break needle tips under microscopic guidance

  • Calibrate injection volume using mineral oil and measuring droplet diameter

  • Test needle flow rate before embryo injection

Injection parameters:

  • Optimize injection volume (typically 5-10 nL for early embryos)

  • Determine appropriate protein concentration through dose-response experiments

  • Target specific blastomeres based on fate mapping data for tissue-specific effects

  • For cell-autonomous effects, include fluorescent dextran (e.g., Fluoro-Ruby) to track injected cells

Developmental timing:

  • For earliest protein function, inject at 1-cell stage

  • For targeted tissue effects, inject specific blastomeres at 2-8 cell stages

  • For later functions, consider using photo-caged proteins that can be activated at specific developmental times

Post-injection handling:

  • Culture embryos in 1/3 MMR solution as used in similar Xenopus injection experiments

  • Regularly remove dead or abnormally developing embryos

  • Score phenotypes at multiple developmental stages

  • Compare with control injections (denatured protein, buffer-only)

Validation approaches:

  • Confirm protein delivery using Western blot of injected embryos

  • Use fluorescently labeled protein to visualize distribution

  • Include co-injection controls (known proteins with established phenotypes)

This methodological approach has been successfully used for similar protein functional studies in Xenopus, such as the Xcdc6 mRNA injection experiments described in the research literature , and can be adapted specifically for Vezatin protein studies.

How does Xenopus laevis Vezatin compare with Vezatin homologs in other model organisms?

Comparing Xenopus laevis Vezatin with homologs in other model organisms provides valuable evolutionary and functional insights. This comparative analysis reveals both conserved and divergent features that inform experimental design and interpretation:

Sequence conservation analysis:
The full-length Xenopus laevis Vezatin consists of 774 amino acids . Comparative sequence analysis with Vezatin homologs shows:

  • Highest conservation in functional domains, particularly those involved in cytoskeletal interactions

  • More divergence in regulatory regions, reflecting species-specific developmental contexts

  • Conservation patterns that correlate with evolutionary relationships among vertebrates

Functional comparison across model systems:

  • Mouse: Vezatin functions in adherens junction stability and acts as a linker between myosin VIIA and the cadherin-catenin complex

  • Zebrafish: Similar to Xenopus, serves as a valuable developmental model with externally developing embryos

  • Drosophila: The Vezatin homolog shows conserved roles in junction integrity during morphogenesis

Expression pattern comparison:

  • Temporal expression dynamics during embryogenesis vary between species, reflecting differences in developmental timing

  • Tissue-specific expression patterns show both conserved (neural, epithelial) and divergent aspects

  • Subcellular localization patterns at adherens junctions appear largely conserved across vertebrates

Experimental advantage comparison:
Xenopus offers specific advantages for Vezatin studies compared to other models:

  • Large embryo size facilitates microinjection and manipulation compared to zebrafish or Drosophila

  • External development allows continuous observation unlike mouse models

  • Established tools for protein expression manipulation (morpholinos, CRISPR) are well-optimized for Xenopus

  • Amenability to mechanical manipulation experiments makes Xenopus ideal for studying Vezatin's role in mechanotransduction

Evolutionary insights:

  • Conservation of Vezatin across diverse species suggests fundamental roles in cell adhesion and morphogenesis

  • Species-specific modifications may reflect adaptation to different developmental constraints

  • Xenopus, as an amphibian model, provides insights into the evolution of Vezatin function between aquatic and terrestrial vertebrates

This comparative approach facilitates the translation of findings between model systems and helps identify which aspects of Vezatin function discovered in Xenopus may be most relevant to human development and disease.

What approaches can be used to study the role of Vezatin in mechanical stress responses during Xenopus development?

Studying Vezatin's role in mechanical stress responses during Xenopus development requires specialized approaches that capitalize on the unique advantages of this model system:

Controlled mechanical stress application:
Xenopus embryos and tissues are excellent models for investigating mechanical properties and responses to physical forces . To study Vezatin's role:

  • Apply reproducible strain to Xenopus embryonic tissue using custom-designed stretching apparatus

  • Compare responses in control versus Vezatin-depleted tissues

  • Analyze both immediate (cytoskeletal reorganization) and long-term (gene expression) responses

  • Quantify tissue mechanical properties using methods such as atomic force microscopy

Live imaging of stress responses:

  • Generate transgenic reporter lines expressing fluorescently tagged Vezatin

  • Combine with cytoskeletal markers such as LifeAct-GFP (actin) or EB3-GFP (microtubules)

  • Perform high-resolution time-lapse microscopy during application of mechanical stress

  • Quantify Vezatin redistribution and recruitment to mechanically stressed sites

Integration with known mechanosensitive pathways:

  • Test for interactions between Vezatin and known mechanosensors (e.g., Piezo channels)

  • Analyze activation of mechanosensitive signaling pathways (e.g., YAP/TAZ) in normal versus Vezatin-depleted contexts

  • Use calcium signaling sensors in neural tissue to assess if Vezatin influences mechanically induced signaling

Tissue explant studies:

  • Culture explants from specific Xenopus tissues (animal caps, marginal zone)

  • Apply defined mechanical forces using substrate stretching or micropipette aspiration

  • Analyze Vezatin localization before, during, and after mechanical perturbation

  • Compare results across different tissue types with varying mechanical properties

Molecular force sensors:

  • Design FRET-based tension sensors incorporating Vezatin or its binding partners

  • Express these constructs in Xenopus embryos or explants

  • Measure changes in FRET efficiency during development and under mechanical stress

  • Correlate molecular tension with tissue-level mechanical events

These approaches can be implemented similar to methods described for studying mechanical forces present during development and growth in other systems , but specifically adapted to investigate Vezatin's potential mechanosensitive functions in Xenopus. The findings would provide insights into how Vezatin may contribute to the translation of mechanical stimuli into cellular responses during embryonic development.

How might findings from Vezatin studies in Xenopus translate to understanding human developmental disorders?

Research on Vezatin in Xenopus laevis provides valuable insights that can be translated to understanding human developmental disorders, particularly those involving cell adhesion, tissue morphogenesis, and cytoskeletal regulation:

Developmental pathway conservation:
Many fundamental developmental pathways are highly conserved between Xenopus and humans. Understanding Vezatin's role in these pathways in Xenopus can illuminate potential mechanisms in human development:

  • Similar to studies that first defined TGFβ family signaling through Smad pathways in Xenopus , Vezatin research may uncover conserved mechanisms relevant to human epithelial and neural development

  • The detailed understanding of spatial and temporal regulation of Vezatin during development can help pinpoint critical periods when disruption might lead to human developmental defects

  • Protein interaction networks identified in Xenopus can guide investigation of orthologous human protein complexes

Model for congenital disorders:
Vezatin dysfunction may contribute to human developmental disorders involving:

  • Neural tube defects: If Vezatin is involved in neural fold elevation and closure in Xenopus

  • Epithelial morphogenesis disorders: Based on Vezatin's potential role in cell junction integrity

  • Sensory system development: By extrapolating from Vezatin's known role in mammalian inner ear development

Methodological translation:
The experimental approaches developed in Xenopus can be adapted to studying human development:

  • Protein interaction studies from Xenopus can inform design of similar studies with human proteins

  • Phenotypic consequences of Vezatin manipulation in Xenopus can guide interpretation of human genetic variants

  • Rescue experiments using human Vezatin in Xenopus knockdown models can test functionality of human mutations

Therapeutic development pathway:
Insights from Xenopus research may contribute to therapeutic approaches:

  • Identification of critical Vezatin domains and interactions can guide drug design targeting specific functions

  • Understanding temporal requirements for Vezatin function can inform intervention timing

  • Clarification of pathway interactions may reveal alternate therapeutic targets when Vezatin function is compromised

The large-scale embryo manipulations possible in Xenopus, combined with its well-characterized development and conserved genome with humans, creates an ideal system for translational research connecting basic developmental mechanisms to human health applications. The tradition of landmark advances in Xenopus contributing to fundamental understanding of human biology suggests that Vezatin studies in this model will likely yield similarly valuable translational insights.

What innovative techniques are emerging for studying protein function in Xenopus that could be applied to Vezatin research?

Several cutting-edge techniques are emerging in Xenopus research that could significantly advance our understanding of Vezatin function:

Genome editing and transgenesis advances:

  • Optimized CRISPR/Cas9 protocols for highly efficient gene editing in Xenopus

  • Targeted integration approaches using homology-directed repair

  • Conditional/inducible gene disruption systems (e.g., Tet-On/Off, heat shock promoters)

  • CRISPR interference (CRISPRi) and activation (CRISPRa) for modulating gene expression without DNA editing

  • Application of these techniques could enable precise temporal and spatial control of Vezatin expression

Advanced imaging technologies:

  • Light sheet microscopy for whole-embryo, long-term 4D imaging with minimal phototoxicity

  • Super-resolution microscopy (STED, PALM, STORM) for nanoscale visualization of Vezatin localization

  • Optogenetic tools for light-controlled protein activation, localization, or degradation

  • Techniques like the histone H3 lysine 9 acetylation sensor for in vivo epigenetic analysis could be adapted to study Vezatin regulation

Single-cell and spatial omics:

  • Single-cell RNA-seq to identify cell populations affected by Vezatin manipulation

  • Spatial transcriptomics to map gene expression changes in response to Vezatin alteration

  • Proteomics and phosphoproteomics to characterize signaling networks

  • Combining these approaches with the established strengths of Xenopus proteomics would provide unprecedented resolution of Vezatin's role

Microfluidic and organoid approaches:

  • Microfluidic devices for precise control of embryonic microenvironments

  • Xenopus organoid cultures to study Vezatin in specific tissue contexts

  • Biomechanical manipulation platforms integrated with live imaging

Biomolecular condensate analysis:

  • Tools to study protein phase separation and condensate formation in vivo

  • Analysis of how Vezatin might participate in or regulate membraneless organelles

  • Correlation with developmental transitions like the mid-blastula transition

Biosensor technologies:

  • FRET-based sensors to detect protein-protein interactions in living embryos

  • Tension sensors to measure mechanical forces at cell junctions where Vezatin may function

  • Integration with existing reporter lines for signaling activity to place Vezatin in developmental pathways

  • Adaptation of the neural tissue-specific calcium signaling sensor to study Vezatin's role in neural development

The application of these innovative techniques to Vezatin research would build upon the established advantages of Xenopus as a model system while leveraging cutting-edge technologies to gain unprecedented insight into protein function during development. The large embryo size, external development, and experimental accessibility of Xenopus make it particularly well-suited for the implementation of these advanced methodologies.

What are the key unanswered questions regarding Vezatin function in development that Xenopus models could help address?

Several critical questions about Vezatin function remain unanswered and could be specifically addressed using Xenopus models:

1. Developmental timing and regulation:

  • How is Vezatin expression and localization dynamically regulated during key developmental transitions?

  • Does Vezatin expression change significantly at the mid-blastula transition (MBT) when the embryo shifts from maternal to zygotic control?

  • Is Vezatin subject to post-translational modifications that alter its function during development?

These questions can be addressed using the quantitative proteomics approaches successfully applied in Xenopus , which have generated comprehensive expression dynamics for thousands of proteins from fertilized egg to neurula embryo.

2. Tissue-specific functions:

  • Does Vezatin play distinct roles in different tissues during Xenopus development?

  • Are there tissue-specific binding partners that modify Vezatin function?

  • How does Vezatin contribute to tissue-specific mechanical properties?

Xenopus is ideal for addressing these questions due to its well-established fate maps and the ability to target specific tissues through blastomere injection .

3. Cytoskeletal organization and morphogenesis:

  • How does Vezatin integrate with the cytokeratin network that plays crucial structural roles in early Xenopus development?

  • Does Vezatin function similarly to RNAs like Xlsirts and VegT that maintain cytokeratin network architecture ?

  • What is Vezatin's role in translating cell shape information to spindle orientation during morphogenetic movements?

The established methods for studying mechanical forces and spindle orientation in Xenopus provide powerful tools to address these questions.

4. Mechanosensitive properties:

  • Does Vezatin participate in mechanosensing or mechanotransduction during development?

  • How does Vezatin respond to and/or regulate tissue stiffness during morphogenesis?

  • Is Vezatin involved in orienting cell divisions in response to mechanical strain?

Xenopus embryos have proven excellent for investigating mechanical properties and cell division within tissues , making them ideal for studying these aspects of Vezatin function.

5. Interactions with signaling pathways:

  • Does Vezatin modulate established developmental signaling pathways (Wnt, TGFβ, FGF)?

  • Could Vezatin function through existing signaling reporter lines in Xenopus ?

  • Does Vezatin influence apoptosis pathways similar to other regulatory proteins like XCdc6 ?

The transgenic reporter lines available in Xenopus for various signaling pathways provide ready-made tools to address these questions.

6. Evolutionary conservation and divergence:

  • How do the functions of Vezatin in Xenopus compare to those in other vertebrates?

  • Are there amphibian-specific adaptations of Vezatin function?

  • Which domains and interactions are most highly conserved across species?

The complementary use of Xenopus laevis and Xenopus tropicalis provides a powerful comparative system to address evolutionary questions within amphibians before extending to broader comparisons.

Addressing these questions using the unique advantages of Xenopus would significantly advance our understanding of Vezatin's fundamental role in development and potentially illuminate its contribution to human developmental disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.