Recombinant Xenopus laevis Voltage-gated hydrogen channel 1 (hvcn1)

Shipped with Ice Packs
In Stock

Description

Overview of HVCN1

HVCN1 is a voltage-gated proton channel critical for pH regulation and reactive oxygen species (ROS) production in immune cells, spermatozoa, and other tissues . Unlike canonical ion channels, HVCN1 lacks a dedicated pore domain and instead uses its voltage-sensing domain (VSD) for proton conduction . Key features include:

  • Perfect proton selectivity mediated by Asp112 .

  • Dimeric structure with dual permeation pathways .

  • pH- and voltage-dependent gating, modulated by transmembrane pH gradients .

Recombinant HVCN1: Design and Applications

Recombinant HVCN1 proteins are produced in heterologous systems (e.g., HEK293 cells, Xenopus oocytes) for functional studies. For Xenopus laevis HVCN1, the full-length protein is typically tagged (e.g., His-tag) to facilitate purification and detection .

Table 1: Recombinant HVCN1 Variants Across Species

SpeciesExpression SystemTagApplicationSource
Xenopus laevisHEK293His-tagStructural/functional studiesCreative BioMart
HumanWheat GermNoneAntibody productionCreative BioMart
ZebrafishE. coliGST/HisFunctional screening
MouseMammalian cellsFc/DDKCompound screening

Functional Insights from Comparative Studies

While direct data on Xenopus laevis HVCN1 is sparse, research on orthologs reveals conserved mechanisms:

  • Proton conductance: Human and zebrafish HVCN1 exhibit similar voltage-dependent activation thresholds (≈+20 mV at pH 7.0) .

  • Pharmacology: Guanidine derivatives (e.g., 2GBI) inhibit HVCN1 by binding residues D112, F150, S181, and R211 in the VSD .

  • Temperature sensitivity: Proton currents increase with temperature (Q10 ≈ 4) .

Table 2: Key Functional Parameters of HVCN1 Orthologs

ParameterHuman HVCN1Zebrafish HVCN1Xenopus laevis (Predicted)
Activation threshold+20 mV (pH 7.0)+30 mV (pH 7.0)Similar to human/zebrafish
Zn²⁺ inhibitionIC50 = 100 nM–1 µMNot reportedLikely conserved
Unitary conductance15 fS12 fS~15 fS (estimated)

Research Gaps and Future Directions

  • Xenopus-specific studies: Functional data on recombinant Xenopus laevis HVCN1 remain limited. Comparative electrophysiology and cryo-EM could clarify species-specific adaptations.

  • Therapeutic potential: HVCN1 inhibitors are explored for stroke, cancer, and infertility , but Xenopus models may offer unique insights into developmental roles.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
hvcn1; Voltage-gated hydrogen channel 1; Hydrogen voltage-gated channel 1; HV1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
hvcn1
Target Protein Sequence
MAGCLRHFTSVGDDTKKREWKQEDVEVAYEEPLKNTPHPFIASYSFRGALKWLLSSHKFQ IVIICLVILDALFVLVEVLLDLELLAEKVDHIIPEIFHYLSISVLTFFILEIAGKLYAFR LEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGVIVSVKT RAEEKMHKLKEQKGSLLEKVAQLEQQCAQQEQEIGRLHKLLQEHNVFPAS
Uniprot No.

Target Background

Function
Mediates the voltage-dependent proton permeability of excitable membranes. It forms a proton-selective channel through which protons can pass according to their electrochemical gradient.
Database Links

KEGG: xla:496219

UniGene: Xl.50052

Protein Families
Hydrogen channel family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing functional recombinant Xenopus laevis HVCN1?

Functional recombinant HVCN1 is typically expressed in Xenopus laevis oocytes due to their high translational capacity for membrane proteins. The protocol involves:

  • Subcloning HVCN1 into the pGEMHE vector for T7 RNA polymerase-driven transcription .

  • In vitro transcription using the mMessage mMachine Kit (Ambion) to generate capped RNA (cRNA) .

  • Microinjection of 50 nL/cell at 0.3–1.5 µg/µL cRNA concentration into stage V–VI oocytes .

  • Incubation at 18°C in ND96 medium (96 mM NaCl, 2 mM KCl, 1.8 mM CaCl2, 1 mM MgCl2, 10 mM HEPES) for 1–3 days .

Validation: Confirm channel expression via two-electrode voltage clamp (TEVC) or inside-out patch clamp recordings in proton-free solutions (pH 7.5 extracellular, pH 6.0 intracellular) .

How do researchers measure HVCN1 proton currents experimentally?

Proton currents are quantified using inside-out patch clamp configurations under symmetrical pH conditions:

  • Voltage protocols: Step depolarizations from -60 mV to +80 mV (10 mV increments, 500 ms duration) .

  • Solution composition:

    ParameterIntracellularExtracellular
    pH6.07.5
    [Na+]96 mM96 mM
    [Cl-]104 mM104 mM
    Proton permeabilityBlocked by 2GBI (IC50 = 16.7 µM)

Key metric: Conductance-voltage (G-V) curves fitted with Boltzmann functions to derive midpoint activation voltage (V½) and slope factor .

What pharmacological tools are available for HVCN1 inhibition studies?

Guanidine derivatives are the primary HVCN1 inhibitors:

CompoundStructureApparent Kd (µM)Binding Site Orientation
2GBIBenzo-imidazole-guanidine16.7 ± 1.8 Intracellular vestibule (D112, F150, S181, R211)
ClGBI5-Chloro-2GBI26.3 ± 2.2 Extracellular access via membrane partitioning

Methodological note: Pre-incubate inhibitors for 5 minutes before recordings to achieve steady-state block .

How to design mutational studies to resolve HVCN1’s voltage-sensing domain (VSD) dynamics?

Step 1: Target residue selection based on sequence alignment (e.g., D112 in S1, F150 in S2, S181 in S3, R211 in S4) .
Step 2: Mutant cycle analysis to quantify pairwise coupling energies (ΔΔG) between residues and inhibitors . Example workflow:

  • Measure inhibition dose-response curves for WT and mutants (e.g., D112A, F150L).

  • Calculate coupling energy:
    ΔΔG=RTln(Kd,mutantKd,WT)\Delta\Delta G = -RT \ln \left( \frac{K_{d, mutant}}{K_{d, WT}} \right)

  • Map residues with |ΔΔG| > 1.5 kcal/mol as functionally coupled .

Key finding: D112 and R211 form a hydrogen-bonding network critical for 2GBI binding (ΔΔG = 2.8 kcal/mol) .

How to reconcile contradictory data on HVCN1 inhibitor efficacy across cell types?

Case study: ClGBI inhibits recombinant HVCN1 in oocytes (Kd = 26.3 µM) but shows reduced potency in RAW264.7 macrophages .
Resolution strategy:

  • Control for endogenous regulators: Co-express NADPH oxidase (NOX) to mimic physiological H+ efflux .

  • Adjust ΔpH gradients: Native cells exhibit steeper pH gradients (ΔpH = 1.5–2.0) that alter inhibitor access .

  • Validate with gating current recordings: Use non-conducting mutants (e.g., D160N) to isolate voltage-sensor modulation .

Data interpretation: Native cell lipid composition and accessory proteins (e.g., NOX2) may occlude inhibitor binding sites .

What biophysical models explain HVCN1’s ΔpH-dependent gating?

The allosteric gating model integrates voltage and ΔpH dependencies:
Q(V)=Qmax1+exp(zF(VV½+αΔpH)RT)Q(V) = \frac{Q_{\text{max}}}{1 + \exp\left( \frac{-zF(V - V_{½} + \alpha \Delta pH)}{RT} \right)}

  • α\alpha: Coupling coefficient (0.6 for Ciona-HV1)

  • zz: Apparent gating charge (1.2–1.5 e0)

Experimental validation:

  • Shift V½ by -40 mV per unit ΔpH increase .

  • Disrupt pH sensing via H193A mutation (abolishes ΔpH response) .

Table 1: Troubleshooting HVCN1 Expression and Function

IssueSolutionSource
Low proton currentsIncrease cRNA concentration to 1.5 µg/µL
Non-specific inhibitionUse 100 µM Zn2+ as positive control
Voltage sensor driftPre-hold at -80 mV for 30 s pre-recording

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.