Recombinant Xenopus laevis Zinc finger protein-like 1 (zfpl1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant ZFPL1 is expressed in diverse systems, optimized for yield and functional activity:

Host SystemAdvantagesApplications
E. coliHigh yield, low costStructural studies, binding assays
YeastEukaryotic post-translational modificationsFunctional assays, ELISA
Mammalian CellsNative-like folding and activityReceptor-binding studies

Purification involves:

  • Affinity Chromatography: His-tagged proteins via Ni-NTA columns .

  • Gel Filtration: Ensures oligomerization state .

Functional Roles and Research Findings

ZFPL1 exhibits diverse roles in cellular processes:

Golgi Integrity

ZFPL1 interacts with GM130 to stabilize the cis-Golgi matrix, ensuring proper cargo trafficking. Depletion disrupts Golgi structure and delays cargo delivery .

Cancer Biomarker

In prostate cancer, ZFPL1 is upregulated by calcitonin and androgens, secreted via exosomes, and detected in serum at 4-fold higher levels in patients .

Cancer-Related FunctionMechanismOutcome
ProliferationPI3K-Akt pathway activationIncreased cell growth
Apoptosis ResistanceSuppression of pro-apoptotic signalsEnhanced survival
MetastasisExosomal secretion promotes tumor spreadElevated invasion capacity

RNA Binding (Related Homologs)

While Xenopus ZFPL1’s RNA-binding capacity is not directly studied, homologs like dsRBP-ZFa (7 zinc fingers) bind dsRNA with nanomolar affinity .

Applications in Research

Recombinant ZFPL1 is used in:

  • ELISA: Quantifying ZFPL1 levels in serum or lysates .

  • Western Blot: Detecting post-translational modifications (e.g., phosphorylation) .

  • Protein Interaction Studies: Mapping GM130-binding regions via mutagenesis .

Key Research Challenges and Future Directions

  • Structural Elucidation: High-resolution crystallography to resolve ZFPL1-RNA or GM130 interactions.

  • Therapeutic Potential: Targeting ZFPL1 in cancers with neuroendocrine phenotypes .

  • Evolutionary Conservation: Comparative studies across Xenopus, mammals, and model organisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your needs as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. This can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing that tag.
Synonyms
zfpl1; Zinc finger protein-like 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
zfpl1
Target Protein Sequence
MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNTLLSSKETARLVCYDLFHWSCLNDLATQQPPNTAPAGYRCPSCQGPVFPPNNLVSPVAATLREKLSTVNWARAGLGLPLIEVAEPVDDTMSHDETDYRDWSVVNSSSDNLSETPETTSQTGYTYNSVAPGAVQQSLNGNMSQDHAVTIRDTGSESVPFNAASSPRKVYDTRENARGQDAVIDFDDDKYRRRPTLNWLARILRNRSGSKSRPASSMQRFLVILIIGVLGFLTLILLMSKLGRASADNDPNLDPLLNPHIHVGKE
Uniprot No.

Target Background

Function
Essential for maintaining cis-Golgi integrity and efficient ER-to-Golgi transport.
Database Links

KEGG: xla:100036939

UniGene: Xl.51821

Protein Families
ZFPL1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Single-pass membrane protein.

Q&A

What are the defining structural features of zinc finger domains in Xenopus laevis proteins?

Zinc finger domains in Xenopus laevis proteins are characterized by their coordination of zinc ions (Zn²⁺) which stabilize their protein fold. The classic example is the transcription factor IIIA from Xenopus laevis, which gave rise to the term "zinc finger" due to the finger-like appearance of its structure . These domains typically contain conserved cysteine and histidine residues that coordinate zinc binding .

The structural arrangement varies between different zinc finger types. For example, the seven-zinc finger protein ZFa from Xenopus laevis contains zinc finger domains connected by unstructured linkers. Specifically, the first finger consists of a three-stranded beta-sheet and three helices, while the second finger contains only a two-stranded sheet and two helices . Despite these differences, the core regions of different fingers can be structurally superimposable, and many zinc fingers present a highly electropositive surface often mapping to a helix-kink-helix motif .

How do zinc finger proteins from Xenopus laevis differ from those in mammalian systems?

While zinc finger domains are evolutionarily conserved, Xenopus laevis zinc finger proteins often show unique structural and functional adaptations. The zinc finger domains of Xenopus proteins like ZFa represent novel motifs for binding double-stranded RNA that differ from mammalian counterparts such as JAZ and wig proteins . These differences are apparent when comparing binding interfaces - the alignment of ZFa zinc fingers with mammalian zinc finger structures fails to produce a consistent picture of RNA-binding interfaces .

In terms of molecular function, zinc finger proteins like Zar2 in Xenopus laevis play specific roles in developmental processes not always conserved in mammals. For instance, Xenopus Zar2 is implicated in translational repression in immature oocytes, with levels that decrease during oocyte maturation . This temporal regulation supports its role in controlling maternal mRNA translation, which may have organism-specific adaptations in amphibian development compared to mammalian systems.

What expression patterns are observed for zinc finger proteins during Xenopus development?

Zinc finger proteins in Xenopus laevis show stage-specific expression patterns during development. For example, Zar2 is present throughout oogenesis but shows reduced levels during oocyte maturation . Western blot analysis of immature and progesterone-stimulated mature oocytes shows that endogenous Zar2 migrates at approximately 39 kDa (slightly higher than its predicted molecular weight of 35 kDa), and its expression is more intense in immature oocytes compared to mature oocytes .

This developmental regulation is consistent with the functional role of certain zinc finger proteins in maternal mRNA regulation. The presence of these proteins during specific developmental windows allows precise temporal control of gene expression, which is crucial for proper embryonic development in Xenopus laevis.

What are the recommended protocols for purifying recombinant Xenopus laevis zinc finger proteins?

When purifying recombinant Xenopus laevis zinc finger proteins, researchers should consider the following methodological approach:

  • Expression system selection: Eukaryotic expression systems are often preferred for zinc finger proteins due to potential post-translational modifications. For example, Zar2 consistently migrates slightly larger than predicted in several eukaryotic cell types, suggesting post-translational modification .

  • Affinity tag strategy: Utilize affinity tags such as GST or His tags for simplified purification. GST-Zar2 fusion proteins have been successfully expressed in immature oocytes and recognized by both N-terminal and C-terminal antibodies .

  • Zinc supplementation: Maintain appropriate zinc concentrations during purification since zinc finger functionality depends on zinc coordination. RNA binding assays with Zar2 have demonstrated that the presence of Zn²⁺ is required for proper protein function .

  • Buffer considerations: Use buffers that maintain protein stability while preventing zinc chelation. Avoid strong chelating agents that might strip zinc ions from the protein.

  • Size validation: Verify purified protein size by SDS-PAGE. Note that zinc finger proteins may migrate differently than their predicted molecular weight - Xenopus Zar2 migrates at approximately 39 kDa despite a predicted molecular weight of 35 kDa .

How can I confirm the RNA-binding specificity of a recombinant Xenopus zinc finger protein?

To confirm RNA-binding specificity of recombinant Xenopus zinc finger proteins, implement a multi-faceted approach:

  • Electrophoretic Mobility Shift Assays (EMSAs): This technique has been successfully used to demonstrate that Zar2 binds specifically to the Translational Control Sequence (TCS) in the Wee1 3'UTR . By comparing binding to target versus non-target RNA sequences, you can establish binding specificity.

  • Yeast Three-Hybrid Assays: This approach effectively confirms RNA-protein interactions in a cellular context. Researchers have used this method to confirm Zar2 binding to TCS elements .

  • Co-immunoprecipitation with RNA analysis: Immunoprecipitate your zinc finger protein and analyze associated RNAs by RT-PCR or sequencing. This approach demonstrated that endogenous Zar2 co-immunoprecipitated with endogenous Wee1 mRNA from immature oocytes, confirming the physiological relevance of this interaction .

  • Zinc-dependence testing: Include controls with and without zinc to confirm that binding requires zinc coordination. For Zar2, RNA binding required the presence of Zn²⁺ and conserved cysteines in the C-terminal domain, supporting its classification as a zinc finger RNA-binding protein .

  • Competition assays: Use unlabeled RNA competitors to demonstrate sequence specificity of the interaction between your zinc finger protein and its putative target.

What antibody generation strategies are effective for studying Xenopus zinc finger proteins?

Effective antibody generation for Xenopus zinc finger proteins requires careful epitope selection and validation approaches:

  • Domain-specific targeting: Generate antibodies against distinct domains for different applications. For Zar2, antibodies raised against peptides in both the C-terminal and N-terminal domains have proven effective for different applications - the C-terminal antibody being particularly useful for western blotting while the N-terminal antibody works well for immunoprecipitation .

  • Epitope selection criteria:

    • Choose regions with minimal sequence conservation between related proteins to ensure specificity

    • For Zar2, researchers selected a peptide in the C-terminal domain with the most mismatches between Zar2 and Zar1 (amino acids 267-286)

    • For immunoprecipitation, select peptides predicted to be on the protein surface (e.g., amino acids 29-44 for Zar2)

  • Validation protocols:

    • Express recombinant tagged protein (e.g., GST-Zar2) in the appropriate system

    • Perform western blot with the generated antibody and compare with tag-specific antibody

    • Conduct peptide competition assays by pre-incubating the antibody with the immunizing peptide before western blot to demonstrate specificity

    • Test cross-reactivity with related proteins (e.g., verification that the antibody recognizes Zar2 but not Zar1)

  • Application-specific validation: Verify antibody performance in the specific applications intended, as antibodies may perform differently in western blot versus immunoprecipitation or immunofluorescence studies.

How can I determine if my recombinant Xenopus zinc finger protein functions in translational regulation?

To assess translational regulatory function of recombinant Xenopus zinc finger proteins, consider the following methodological approaches:

  • Dual luciferase reporter tethered assays: This technique effectively demonstrates translational effects in Xenopus oocytes. For example, this approach showed that Zar2 represses translation in immature oocytes, with repression being relieved during oocyte maturation coincident with Zar2 degradation .

  • In vitro translation assays: Compare translation efficiency of target mRNAs with and without your purified recombinant zinc finger protein in cell-free translation systems.

  • Polysome profiling: Analyze the association of target mRNAs with polysomes in the presence or absence of your zinc finger protein to determine effects on translation initiation or elongation.

  • Developmental context analysis: Assess protein levels at different developmental stages along with target mRNA translation, as was done for Zar2, which showed decreased levels during oocyte maturation correlating with relief of translational repression .

  • Domain mutation analysis: Create specific mutations in key zinc finger domains to determine which regions are essential for translational regulation. For Zar2, RNA binding required conserved cysteines in the C-terminal domain, suggesting the zinc finger structure is critical for its function .

What role do Xenopus zinc finger proteins play in genome integrity and DNA repair?

Zinc finger proteins in Xenopus, as in other organisms, play crucial roles in maintaining genome integrity through multiple mechanisms:

  • DNA damage recognition and response: Zinc finger domains can recognize and bind to damaged DNA, facilitating recruitment of repair factors. Recent proteomic, cellular and molecular studies have highlighted the involvement of zinc finger proteins as protectors of the genome .

  • Telomere maintenance: Zinc finger domain-containing proteins participate in telomere protection and length regulation in Xenopus, similar to their function in other organisms. This role is critical for preventing chromosome instability and maintaining genome integrity across cell divisions .

  • DNA repair pathway coordination: Zinc finger proteins function in various DNA repair pathways, including double-strand break repair. Their diverse binding capabilities allow them to interact with both DNA structures and other proteins involved in repair complexes .

  • Transcriptional regulation of repair genes: As many zinc finger proteins function as transcription factors, they can regulate the expression of genes involved in DNA repair pathways, forming an additional layer of genome protection .

Understanding these genome maintenance functions is particularly relevant when studying recombinant Xenopus zinc finger proteins, as their structural integrity must be preserved to maintain these critical functions in experimental systems.

How do post-translational modifications affect Xenopus zinc finger protein function?

Post-translational modifications significantly impact the function of Xenopus zinc finger proteins through multiple mechanisms:

  • Altered migration patterns: Xenopus Zar2, which has a predicted molecular weight of 35 kDa, consistently migrates at approximately 39 kDa on polyacrylamide gels when expressed in various eukaryotic cell types, suggesting post-translational modification .

  • Functional regulation: Post-translational modifications can regulate the RNA-binding activity of zinc finger proteins. The zinc-dependent RNA binding observed with Zar2 indicates that proper coordination of zinc ions, which could be affected by certain modifications, is critical for function .

  • Protein stability control: The observed decrease in Zar2 levels during oocyte maturation suggests regulated protein degradation, which is often controlled by specific post-translational modifications such as phosphorylation or ubiquitination .

  • Interaction interface modulation: Zinc fingers can bind to various post-translational modifications including ubiquitin, SUMO, and methylated histones . This suggests that modifications on zinc finger proteins themselves may create or disrupt similar interaction surfaces.

When working with recombinant Xenopus zinc finger proteins, researchers should consider which expression system will best recapitulate the natural post-translational modification pattern. Eukaryotic expression systems are often preferable to bacterial systems for this reason, particularly when studying zinc finger proteins involved in complex regulatory processes.

How can zinc finger domain structures from Xenopus be utilized for protein engineering applications?

The unique structural characteristics of Xenopus zinc finger domains offer valuable templates for protein engineering applications:

  • RNA-binding module design: The novel double-stranded RNA binding motif identified in Xenopus ZFa zinc fingers represents a unique structural template for engineering RNA-binding proteins . Unlike other RNA-binding domains, these zinc fingers contain distinct electropositively charged surfaces that map to helix-kink-helix motifs that could be adapted for target-specific RNA recognition .

  • Domain independence utilization: The lack of evidence for interactions between adjacent zinc finger domains in proteins like ZFa, consistent with the length (24 residues) and unstructured nature of their intervening linker , suggests that individual fingers could be engineered as independent binding modules and then combined in novel arrangements.

  • Hybrid domain construction: The structural similarities between Xenopus zinc fingers and other DNA-binding, protein-interaction, and RNA-binding domains that don't contain zinc create opportunities for designing hybrid domains with novel binding specificities and functions.

  • Developmental regulators: The translational regulatory properties of zinc finger proteins like Zar2 could be harnessed to create engineered translational regulators with temporal specificity for controlling gene expression in developmental biology applications.

  • Genome integrity enhancement: The involvement of zinc finger domains in genome integrity and DNA repair suggests potential applications in designing proteins that could enhance DNA repair in cellular models of disease or aging.

What approaches can resolve contradictory data regarding zinc finger protein functions in Xenopus?

When facing contradictory data about zinc finger protein functions in Xenopus, researchers should implement the following methodological approaches:

  • Domain-specific functional analysis: Separate the protein into functional domains for independent testing. For example, the C-terminal half of Zar2 binds RNA while the N-terminal half regulates mRNA translation . This approach can help resolve contradictions by demonstrating that a single protein may perform multiple, context-dependent functions.

  • Developmental timing precision: Carefully control and document the developmental stage of samples, as zinc finger protein expression and function can change dramatically during development. The observation that Zar2 levels decrease during oocyte maturation demonstrates how timing affects function and could explain contradictory results obtained at different developmental stages.

  • Antibody validation rigor: Use multiple antibodies targeting different epitopes and thoroughly validate each with peptide competition assays . Contradictory western blot data could result from antibodies recognizing different isoforms or cross-reacting with related proteins.

  • Paralog disambiguation: For pseudotetraploid organisms like Xenopus laevis, clearly identify which paralog is being studied. Researchers have proposed nomenclature clarification by designating certain zinc finger genes as paralogs (e.g., Xzar2a and Xzar2b) , which helps resolve contradictions arising from studying different genes with high sequence similarity.

  • Post-translational modification analysis: Investigate potential post-translational modifications that might explain functional differences, as suggested by the observation that Xenopus Zar2 consistently migrates at a higher apparent molecular weight than predicted .

How does the binding specificity of Xenopus zinc fingers compare across different molecular targets?

Xenopus zinc finger domains exhibit remarkable binding versatility across different molecular targets with distinct structural characteristics:

  • DNA vs. RNA binding: While zinc fingers were first characterized as DNA-binding domains in Xenopus laevis transcription factor IIIA , proteins like ZFa demonstrate specific binding to double-stranded RNA through a novel structural motif . This dual capability illustrates the evolutionary adaptability of the zinc finger fold to recognize different nucleic acid structures.

  • Sequence vs. structure recognition: The zinc fingers in ZFa represent a novel motif for binding double-stranded RNA that doesn't align with canonical RNA-binding interfaces , suggesting recognition of unique structural features rather than simple sequence motifs.

  • Protein-interaction capabilities: Beyond nucleic acids, zinc finger domains can mediate protein-protein interactions and bind to modified proteins including those with post-translational modifications such as ubiquitin, SUMO, and methylated histones . This broad interaction potential emerges from the structural plasticity of zinc finger domains.

  • Target specificity determinants: The specificity of Zar2 for the Translational Control Sequence (TCS) in maternal mRNAs like Wee1 exemplifies how certain zinc finger arrangements achieve high target selectivity through recognition of specific RNA sequences or structures.

  • Zinc-dependence variations: RNA binding by Zar2 requires the presence of Zn²⁺ and conserved cysteines in the C-terminal domain , demonstrating that the zinc coordination is critical for certain binding interactions, while other interactions might be less dependent on the zinc-coordinated structure.

How are zinc finger domains conserved between Xenopus laevis and other vertebrate species?

Zinc finger domains show significant evolutionary conservation across vertebrates while maintaining species-specific adaptations:

  • Core structural conservation: The fundamental zinc-coordinating motifs involving cysteine and histidine residues are highly conserved between Xenopus laevis and other vertebrates . This conservation reflects the critical importance of zinc coordination for structural stability across evolutionary lineages.

  • Functional divergence: Despite structural conservation, functional specialization is evident. For example, the Xenopus ZFa zinc fingers represent a novel motif for binding double-stranded RNA that differs from comparable mammalian proteins , indicating functional divergence despite maintained core structure.

  • Paralog relationships: In Xenopus laevis, a pseudotetraploid organism, many zinc finger proteins exist as paralogs (e.g., Xzar2a and Xzar2b) , reflecting the genome duplication event in this species' evolutionary history. This creates a more complex evolutionary relationship with orthologs in diploid vertebrates.

  • Developmental role conservation: Zinc finger proteins like Zar (Zygote arrest) are crucial for early embryonic development across vertebrate species, though their precise molecular mechanisms may vary . This represents conservation of broad developmental function despite potential differences in specific molecular activities.

  • Binding interface evolution: Comparison of zinc finger structures from Xenopus with those from other organisms shows similarities in topology and arrangement of secondary structure elements with canonical DNA-binding zinc fingers and protein interaction motifs , suggesting evolutionary relationships despite adaptations for different binding partners.

What is known about the evolution of distinct zinc finger subtypes in amphibians compared to mammals?

Evolutionary analysis reveals several key differences in zinc finger subtypes between amphibians and mammals:

  • Novel RNA-binding motifs: Xenopus laevis contains zinc finger proteins like ZFa with unique double-stranded RNA binding motifs not found in the same configuration in mammalian systems . The alignment of ZFa zinc fingers with various mammalian structures fails to produce a consistent picture of an RNA-binding interface, suggesting independent evolutionary adaptation .

  • C2H2 distribution differences: While C2H2 zinc finger proteins represent one of the largest families of regulatory proteins in mammals, with human genomes containing over 650 C2H2 zinc finger proteins , the distribution and diversity of these proteins in Xenopus shows distinct evolutionary patterns related to its unique developmental requirements.

  • Developmental regulator adaptations: Zinc finger proteins involved in developmental regulation, such as Zar2 in Xenopus, show specific adaptations related to the distinctive aspects of amphibian development, particularly the regulation of maternal mRNAs in oocytes . These adaptations reflect the different reproductive strategies of amphibians compared to mammals.

  • Genome duplication effects: The pseudotetraploid nature of Xenopus laevis has led to the presence of paralogous zinc finger genes that have had opportunity for subfunctionalization or neofunctionalization not possible in mammalian lineages, potentially accelerating evolutionary divergence of zinc finger subtypes.

  • Binding plasticity conservation: Despite lineage-specific adaptations, the extraordinary binding plasticity of zinc finger domains - including ability to bind DNA, RNA, lipids, proteins and post-translational modifications - appears to be a conserved feature across vertebrate evolution, suggesting fundamental selection pressure to maintain this versatility.

What are the most promising research avenues for Xenopus zinc finger proteins in developmental biology?

Future research on Xenopus zinc finger proteins in developmental biology should focus on several promising directions:

  • Maternal mRNA regulation mechanisms: Further characterization of how zinc finger proteins like Zar2 regulate maternal mRNA translation would provide deeper insights into the molecular control of early development. Identifying the complete set of target mRNAs and understanding the kinetics of regulation would be particularly valuable.

  • Developmental timing control: Given the observed decrease in Zar2 levels during oocyte maturation , investigating the mechanisms controlling the temporal expression and degradation of zinc finger proteins during development could reveal fundamental principles of developmental timing regulation.

  • Zinc finger protein networks: Exploring the interactions between different zinc finger proteins and their integration into larger regulatory networks during development would help elucidate how these proteins cooperate to orchestrate complex developmental processes.

  • Genome integrity roles during development: Further investigation of how zinc finger proteins protect genome integrity during rapid embryonic cell divisions would enhance our understanding of how developmental fidelity is maintained in the face of potentially mutagenic processes.

  • Comparative analysis with mammalian systems: Systematic comparison of the functions of orthologous zinc finger proteins between Xenopus and mammalian systems would highlight conserved mechanisms and reveal adaptations specific to amphibian development.

What technological advances would most benefit research on recombinant Xenopus zinc finger proteins?

Several technological advances would significantly enhance research on recombinant Xenopus zinc finger proteins:

  • Improved expression systems: Development of expression systems that better recapitulate the post-translational modifications observed in native Xenopus proteins would address the observed differences between predicted and actual molecular weights of proteins like Zar2 .

  • High-resolution structural analysis: Advanced structural biology techniques to determine the precise three-dimensional structures of Xenopus-specific zinc finger arrangements would enhance our understanding of their unique binding properties, particularly for novel motifs like those in ZFa that bind double-stranded RNA .

  • Domain-specific functional assays: Development of high-throughput methods to assess the specific functions of individual domains within multi-domain zinc finger proteins would help resolve the multifunctional nature of proteins like Zar2, where different domains mediate distinct functions .

  • In vivo tracking technologies: Advanced imaging techniques to track the dynamics of zinc finger proteins during development would provide insights into their temporal and spatial regulation in living embryos.

  • Zinc finger engineering platforms: Development of platforms specifically optimized for engineering Xenopus zinc finger domains could leverage their unique properties for biotechnological applications, particularly those based on their RNA-binding capabilities .

How might research on Xenopus zinc finger proteins inform therapeutic approaches for human diseases?

Research on Xenopus zinc finger proteins offers several potential pathways to inform therapeutic approaches for human diseases:

  • Genome integrity therapeutics: Understanding how zinc finger proteins protect genome integrity could inform the development of therapeutics for diseases characterized by genome instability, including cancer and certain aging-related conditions.

  • RNA-targeted therapeutics: The unique RNA-binding properties of zinc finger domains like those in Xenopus ZFa and Zar2 could serve as templates for designing RNA-targeting therapeutic proteins with high specificity for disease-relevant RNA structures.

  • Developmental disorder insights: Given the crucial role of zinc finger proteins in early development , research in Xenopus could provide insights into the molecular basis of human developmental disorders linked to zinc finger protein dysfunction.

  • Engineered translational regulators: The translational regulatory functions demonstrated by proteins like Zar2 could inspire the design of therapeutic proteins capable of modulating translation of specific disease-associated mRNAs.

  • Cancer biology applications: Since genome instability is a hallmark of cancer, and zinc finger proteins are involved in genome protection , understanding their mechanisms could inform new approaches to cancer therapy targeting genome stability pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.