Recombinant Xenopus laevis Zinc transporter 6-A (slc30a6-a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Zinc Transporter 6-A (slc30a6-a)

Recombinant Xenopus laevis Zinc Transporter 6-A (slc30a6-a) is a recombinant protein derived from the African clawed frog, Xenopus laevis. This protein belongs to the solute carrier family 30 (SLC30), which plays a crucial role in regulating zinc homeostasis within cells by mediating zinc efflux or sequestration into intracellular compartments . The SLC30 family is essential for maintaining proper zinc levels in various cellular compartments, which is vital for numerous biological processes.

Characteristics of Recombinant Xenopus laevis Zinc Transporter 6-A (slc30a6-a)

  • Species: The protein is derived from Xenopus laevis, commonly known as the African clawed frog.

  • Uniprot Number: Q6AZN8.

  • Tag Information: The tag type is determined during the production process.

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for protein stability.

  • Storage Conditions: Store at -20°C for short-term use or -80°C for extended storage. Repeated freezing and thawing should be avoided.

  • Working Aliquots: Store at 4°C for up to one week.

Role in Zinc Homeostasis

Zinc transporters like slc30a6-a are crucial for maintaining zinc balance within cells. Zinc is an essential trace element involved in numerous biological processes, including enzyme function, protein synthesis, and immune response .

Clinical and Biological Significance

Alterations in zinc transporter expression have been linked to various conditions, including zinc deficiency in breastfed neonates . Understanding the function of zinc transporters like slc30a6-a can provide insights into zinc-related disorders and potential therapeutic targets.

Data Tables

CharacteristicsDescription
SpeciesXenopus laevis
Uniprot NumberQ6AZN8
Storage BufferTris-based, 50% glycerol
Storage Conditions-20°C or -80°C
Amino Acid SequenceProvided above

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc30a6-a; znt6-a; Zinc transporter 6-A; ZnT-6-A; Solute carrier family 30 member 6-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-464
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc30a6-a
Target Protein Sequence
MGTIYLFRKTQRSLLGKLAQEFRLVTADRRSWKILLFGAINVVCTAFLLTWCSSTNSMAL TAYTYLTIFDLFSLITSLISYWVTMKKPSPTYSFGFERFEVLAVFASTVLAQLGALFILK ESAERFIEQPEIHTGRLLVGTFVALFFNLFTMLSIRNKPFAYVSDAASTSWLQEHVADLS RSLCGIIPGLSSIFLPRMNPFVLIDIAGALALCITYMLIEINNYFAVDTASAVAIAVMTF GTMYPMSVYSGKVLLQTTPPHVIGQLDKLLREVSTLDGVLEVRNEHFWTLGFGTMAGSVH VRIRRDANEQMVLAHVTNRLSTLVSTLTVQIFKDDWARPVLASGTMPPNMLNIPEHHVIQ MPSLKSTIDELNPLTSTPSKPSSPPPEFAFNTPGKNMNPVILSNNQMRPFGVGYNYGTTP YTTTFNQGLGVPGVGNTQGLRTGLTNVANRYGTYTPGQFTQFRQ
Uniprot No.

Target Background

Function
Zinc-efflux transporter that allocates cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment.
Database Links

KEGG: xla:446666

UniGene: Xl.48482

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is SLC30A6-A (ZnT6-A) in Xenopus laevis and how does it compare to human ZnT6?

SLC30A6-A (ZnT6-A) in Xenopus laevis is a member of the cation diffusion facilitator (CDF) family of membrane transporters involved in zinc homeostasis. It functions primarily to transport zinc from the cytoplasm into the Golgi apparatus and vesicular compartments. The human ortholog (ZNT6/SLC30A6) is mapped to chromosome 2p21-22, while the mouse ortholog (Znt6) is on chromosome 17 .

The Xenopus laevis SLC30A6-A protein consists of 464 amino acids (as a full-length protein) and contains conserved functional domains similar to those found in mammalian ZnT6 proteins . Human ZnT6 plays a critical role in zinc homeostasis and has been implicated in the activation of zinc-dependent ectoenzymes in the early secretory pathway .

What expression systems are commonly used for producing Recombinant Xenopus laevis Zinc transporter 6-A?

The most common expression systems for producing Recombinant Xenopus laevis Zinc transporter 6-A include:

  • E. coli expression system: Commonly used for producing recombinant protein with N-terminal His-tags for purification purposes .

  • Xenopus oocytes: While not typically used for large-scale protein production, Xenopus oocytes are extensively used for functional characterization of zinc transporters due to their ability to correctly fold and express membrane proteins .

  • Mammalian cell lines: Used for studies requiring proper post-translational modifications and cellular localization .

Each system offers distinct advantages depending on the research objectives:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, simple purificationLimited post-translational modificationsStructural studies, antibody production
Xenopus oocytesNative-like membrane environment, functional studiesLow protein yield, labor-intensiveTransport assays, electrophysiology
Mammalian cellsProper folding, post-translational modificationsHigher cost, lower yieldLocalization studies, interaction studies

What is the basic structure and topology of Zinc transporter 6 proteins?

Zinc transporter 6 proteins, including Xenopus laevis SLC30A6-A, belong to the cation diffusion facilitator (CDF) family and typically share the following structural features:

  • Transmembrane domains: ZnT6 is predicted to have 6 transmembrane domains, which is characteristic of the CDF family .

  • Cytoplasmic domain: Contains metal-binding sites important for zinc recognition and transport.

  • N-terminal and C-terminal regions: These regions often contain regulatory elements and protein interaction motifs.

The functional ZnT6 protein typically forms a heterodimer with ZnT5 in the secretory pathway, which is essential for its zinc transport activity . This ZnT5-ZnT6 heterodimer plays a critical role in supplying zinc to the secretory pathway for the activation of zinc-dependent enzymes.

What purification methods are recommended for Recombinant Xenopus laevis Zinc transporter 6-A?

For purification of Recombinant Xenopus laevis Zinc transporter 6-A, the following methods are recommended based on the expression system:

  • For His-tagged proteins from E. coli:

    • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA resin

    • Buffer optimization containing 6% Trehalose, pH 8.0 for stability

    • Lyophilization for long-term storage

  • For membrane proteins from Xenopus oocytes:

    • Membrane isolation followed by solubilization with detergents

    • Affinity purification based on epitope tags

    • Size-exclusion chromatography for final purification

The purified protein should be stored with glycerol (recommended final concentration of 50%) and aliquoted for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles .

How does the ZnT5-ZnT6 heterodimer formation influence zinc transport activity, and what experimental approaches can detect this interaction?

The ZnT5-ZnT6 heterodimer formation is essential for zinc transport activity into the early secretory pathway. Recent studies have revealed a unique spatial regulation mechanism where ZnT5 recruits ZnT6 to the Golgi apparatus to form the heterodimeric complex .

Experimental approaches to detect and characterize this interaction include:

  • Co-immunoprecipitation (Co-IP): Using antibodies against one partner to pull down the complex and detecting the other partner by Western blotting.

  • Bimolecular Fluorescence Complementation (BiFC): By tagging ZnT5 and ZnT6 with complementary fragments of a fluorescent protein, interaction can be visualized as reconstituted fluorescence.

  • Förster Resonance Energy Transfer (FRET): Measuring energy transfer between fluorophore-tagged proteins to detect close proximity.

  • Subcellular localization studies: Using confocal microscopy with fluorescently tagged proteins to observe co-localization.

Research has shown that in human cells, ZnT5 plays a crucial role in recruiting ZnT6 to the Golgi apparatus, and this interaction is required for the activation of zinc-dependent enzymes such as tissue-nonspecific alkaline phosphatase (TNAP) . Disruption of either partner leads to reduced enzyme activation, demonstrating their cooperative function.

What are the functional differences between Xenopus laevis Zinc transporter 6-A (slc30a6-a) and Zinc transporter 6-B (slc30a6-b)?

Xenopus laevis, as a pseudotetraploid organism, expresses two variants of many genes, including slc30a6-a and slc30a6-b. Based on available data:

Key differences include:

Experimental approaches to investigate functional differences include:

  • Heterologous expression in Xenopus oocytes followed by zinc uptake/efflux assays to compare transport kinetics .

  • Tissue-specific expression analysis using RT-PCR or in situ hybridization to map distinct expression domains.

  • Morpholino-mediated knockdown of each variant separately to assess non-redundant functions during development .

Further research is needed to fully characterize the potential functional divergence between these two variants.

How can the zinc transport activity of SLC30A6-A be quantitatively measured in different experimental systems?

Quantitative measurement of SLC30A6-A zinc transport activity can be achieved through several experimental approaches:

In Xenopus oocytes:

  • Radioisotope (65Zn) uptake assays: Measuring the accumulation of radioactive zinc in oocytes expressing SLC30A6-A compared to control oocytes .

  • Two-electrode voltage clamp recordings: Measuring changes in membrane potential or conductance in response to zinc application, although this may be less applicable for electroneutral transporters .

In mammalian cell lines:

  • Zinc-sensitive fluorescent probes: Using fluorescent sensors like FluoZin-3 or Zinpyr-1 to monitor changes in intracellular or organellar zinc concentrations.

  • ICP-MS (Inductively Coupled Plasma Mass Spectrometry): For precise quantification of total cellular zinc content .

  • Zinquin or other zinc-specific dyes: For visualization of zinc localization and semi-quantitative assessment.

In yeast systems:

  • Growth complementation assays: Using zinc-sensitive yeast strains to assess functional complementation by SLC30A6-A .

  • Metal-sensitive promoter-reporter assays: Using zinc-responsive promoters coupled to reporter genes.

Comparative transport kinetics data from different systems:

SystemMeasurement MethodTypical Km ValuesTypical Vmax ValuesAdvantages
Xenopus oocytes65Zn uptakenM-μM rangepmol/oocyte/minPhysiological membrane environment
Mammalian cellsFluorescent probes--Closer to native conditions
YeastGrowth complementation--High-throughput screening

What role does SLC30A6-A play in Xenopus laevis development, and how can this be investigated?

The role of SLC30A6-A in Xenopus laevis development can be investigated through several approaches:

  • Temporal and spatial expression analysis:

    • RT-PCR across developmental stages

    • Whole-mount in situ hybridization to visualize expression domains

  • Loss-of-function studies:

    • Morpholino antisense oligonucleotides targeting slc30a6-a

    • CRISPR/Cas9-mediated knockout

  • Gain-of-function studies:

    • mRNA injection for overexpression

    • Targeted transgenic expression

Zinc transporters are known to play critical roles in various developmental processes. For example, ZIP12 (another zinc transporter) has been shown to be essential for neurulation and neural tube closure in Xenopus tropicalis. Knockdown of ZIP12 leads to impaired neural tube closure and arrests development during neurulation .

By extension, SLC30A6-A may play specific roles in Xenopus development, potentially in:

  • Neural tissue development

  • Organogenesis, particularly of structures requiring high zinc levels

  • Metamorphosis, which involves substantial tissue remodeling

Research on other zinc transporters in Xenopus has shown their importance in critical developmental processes. For instance, knockdown of ZIP10 causes delayed epiboly and deformities of the head, eye, heart, and tail in zebrafish embryos .

What are the optimal conditions for expressing functional Recombinant Xenopus laevis Zinc transporter 6-A in Xenopus oocytes?

Xenopus oocytes provide an excellent system for functional expression of membrane transporters. The optimal conditions for expressing functional Recombinant Xenopus laevis Zinc transporter 6-A include:

Oocyte preparation and maintenance:

  • Use fully grown stage VI oocytes isolated from mature female Xenopus laevis .

  • Defolliculate oocytes by incubating with 1.5 mg/ml collagenase for 0.5-1 hour .

  • Maintain oocytes at 18°C in ND96 solution containing (in mM): 96 NaCl, 2 KCl, 1 MgCl2, 1 CaCl2, 2.5 sodium pyruvate, and 5 HEPES (pH 7.5), plus 50 μg/ml gentamycin .

cRNA preparation and injection:

  • Synthesize capped cRNA using T7 or SP6 RNA polymerase from linearized plasmid DNA containing the full-length slc30a6-a sequence.

  • Inject 2.5-50 ng of cRNA per oocyte depending on desired expression level .

  • Allow 3-5 days for expression at 18°C before performing functional assays.

Functional assays optimization:

  • For zinc transport assays, use appropriate zinc concentrations (typically 1-10 μM) in a suitable buffer system.

  • Control for endogenous zinc transport by comparing with water-injected control oocytes.

  • Consider pH dependence of transport (optimal pH may be specific to the transporter).

What are the key considerations for designing site-directed mutagenesis experiments to investigate structure-function relationships in SLC30A6-A?

Site-directed mutagenesis is a powerful approach to investigate structure-function relationships in zinc transporters. Key considerations for SLC30A6-A include:

Selection of target residues:

  • Conserved residues: Identify amino acids conserved across species, suggesting functional importance.

  • Predicted zinc-binding sites: Typically involving histidine, aspartate, glutamate, or cysteine residues.

  • Transmembrane domains: Residues likely involved in forming the transport pathway.

  • Protein-protein interaction domains: Residues potentially involved in ZnT5-ZnT6 heterodimer formation.

Mutation design strategy:

  • Conservative substitutions: Replace with amino acids of similar properties to test specific chemical requirements.

  • Non-conservative substitutions: Replace with amino acids of different properties to disrupt function.

  • Alanine scanning: Systematically replace residues with alanine to identify essential amino acids.

Experimental validation approaches:

  • Transport activity assays: Measure zinc transport function of mutants compared to wild-type.

  • Protein expression and localization: Ensure mutations don't disrupt protein folding or trafficking.

  • Protein-protein interaction assays: Assess effects on heterodimer formation with ZnT5.

Example mutation targets based on other ZnT proteins:

  • Histidine residues in transmembrane domains (e.g., H451 in ZNT5 has been shown to be critical for zinc transport function) .

  • Residues in cytoplasmic loops that may participate in zinc binding.

  • C-terminal residues potentially involved in protein-protein interactions.

How can electrophysiological techniques be applied to study SLC30A6-A function in Xenopus oocytes?

Electrophysiological techniques, particularly two-electrode voltage clamp (TEVC), can be powerful tools for studying transporter function in Xenopus oocytes, though application to SLC30A6-A presents certain challenges:

TEVC protocol for SLC30A6-A study:

  • Express SLC30A6-A in Xenopus oocytes by injecting 2.5-50 ng cRNA and incubate for 3-5 days at 18°C .

  • Mount oocytes in a recording chamber perfused with standard ND96 buffer.

  • Impale oocytes with two microelectrodes (voltage-sensing and current-injecting).

  • Apply voltage protocols while perfusing solutions containing different zinc concentrations.

Key considerations:

  • Electroneutrality challenge: SLC30A6 likely mediates electroneutral transport (no net charge movement), making direct current measurements challenging . Consider:

    • Co-expression with electrogenic partners

    • Measurement of secondary effects on endogenous conductances

  • Pre-steady-state currents: These represent conformational changes of the transporter and can provide information even if the transport cycle is electroneutral .

  • Temperature dependence: Perform measurements at different temperatures (typically 18-25°C) to estimate Q10 values, which can provide insights into conformational changes involved in transport .

Complementary approaches:

  • pH-sensitive microelectrodes: If transport is coupled to H+ movement.

  • Ion-selective microelectrodes: For direct measurement of intracellular zinc changes.

  • Current fluctuation analysis: To detect small transport-associated currents.

Even for electroneutral transporters, electrophysiological techniques can provide valuable information about transport mechanisms, kinetics, and regulation when properly adapted and complemented with other methods.

What are the most effective methods for studying the subcellular localization of SLC30A6-A in cellular models?

The subcellular localization of SLC30A6-A is critical to understanding its function in zinc homeostasis. Based on studies of mammalian ZnT6, which typically localizes to the trans-Golgi network and vesicular compartments , several approaches can effectively determine SLC30A6-A localization:

Fluorescent protein fusion constructs:

  • Generate C- or N-terminal GFP/YFP/mCherry fusions with SLC30A6-A.

  • Express in appropriate cell lines (Xenopus cell lines, mammalian cells).

  • Visualize using confocal microscopy.

Immunolocalization approaches:

  • Develop specific antibodies against SLC30A6-A or use epitope tags (His, Myc, HA).

  • Perform immunofluorescence with appropriate fixation protocols (4% paraformaldehyde).

  • Co-stain with established organelle markers:

    • TGN38 for trans-Golgi network

    • Transferrin receptor for recycling endosomes

    • Calnexin for ER

    • GM130 for cis-Golgi

Biochemical fractionation:

  • Perform subcellular fractionation to isolate different membrane compartments.

  • Analyze fractions by Western blotting for SLC30A6-A.

  • Compare distribution with known organelle markers.

Advanced imaging techniques:

  • Super-resolution microscopy (STORM, PALM) for precise localization.

  • Live-cell imaging to track dynamic changes in localization.

  • Correlative light and electron microscopy (CLEM) for ultrastructural localization.

Studies of mammalian ZnT6 have shown that its localization can be regulated by zinc levels, with redistribution occurring in response to zinc depletion or excess . Similar regulation might occur for Xenopus SLC30A6-A, making it important to examine localization under different zinc conditions.

How should researchers interpret zinc transport kinetics data from SLC30A6-A functional assays?

Interpreting zinc transport kinetics data for SLC30A6-A requires careful consideration of several factors:

Key kinetic parameters to analyze:

  • Apparent affinity (Km): Reflects the concentration of zinc at which transport rate is half-maximal.

  • Maximum transport rate (Vmax): Indicates the transport capacity when fully saturated.

  • Transport specificity: Determined by comparing transport rates of zinc versus other divalent cations.

Data analysis approaches:

  • Use non-linear regression to fit transport data to appropriate kinetic models:

    • Michaelis-Menten equation for simple transport

    • Hill equation if cooperativity is suspected

    • More complex models if multiple binding sites exist

  • Compare kinetic parameters across experimental conditions:

    • pH dependence may indicate proton coupling

    • Temperature dependence (Q10) suggests conformational changes

    • Effects of inhibitors can reveal transport mechanism

Interpretation challenges:

  • Heterodimer formation: SLC30A6-A likely functions as a heterodimer with ZnT5, complicating kinetic analysis if expressed alone .

  • Background transport: Endogenous zinc transport systems may contribute to measured activities, requiring careful controls.

  • Indirectness of measurements: Many assays measure zinc accumulation rather than transport directly, potentially confounding interpretation.

Example of kinetic analysis from a related zinc transporter:
ZIP12 has been characterized with a Km of approximately 6.6 nM and a Vmax of 2.7 pmol Zn2+·min−1·mg protein−1, indicating high-affinity transport . Similar high-affinity transport might be expected for SLC30A6-A, particularly if it functions in zinc transport into secretory compartments where precise control is necessary.

What are the current challenges and limitations in structural studies of Recombinant Xenopus laevis Zinc transporter 6-A?

Structural studies of membrane transporters like SLC30A6-A face several significant challenges:

Expression and purification challenges:

  • Low expression levels: Membrane proteins typically express at lower levels than soluble proteins.

  • Protein stability: Maintaining native conformation outside the membrane environment is difficult.

  • Purification complexity: Requires detergents or membrane mimetics that may affect structure.

Current technical limitations:

  • Crystallization difficulties: Membrane proteins are notoriously difficult to crystallize due to their hydrophobic surfaces.

  • Conformational heterogeneity: Transporters exist in multiple conformational states, complicating structural determination.

  • Size considerations: The SLC30A6-A/ZnT5 heterodimer complex presents additional challenges due to its size and complexity.

Promising approaches for structural studies:

  • Cryo-electron microscopy (cryo-EM): Can determine structures without crystallization, increasingly viable for membrane proteins.

  • X-ray crystallography with advanced techniques:

    • Lipidic cubic phase crystallization

    • Antibody fragment-mediated crystallization

    • Thermostabilizing mutations

  • Hybrid approaches: Combining low-resolution structural data with computational modeling.

  • Homology modeling: Based on the structures of related transporters like YiiP from bacterial sources .

Recent advances in structural studies of the human zinc transporter ZnT8 provide valuable insights that may be applicable to SLC30A6-A. These studies used molecular dynamics simulations to investigate the conformational changes associated with zinc transport, an approach that could be adapted for SLC30A6-A.

How can researchers effectively compare functional properties of Xenopus SLC30A6-A with mammalian orthologs?

Effective comparison of Xenopus SLC30A6-A with mammalian orthologs requires systematic approaches across multiple parameters:

Sequence and structural comparison:

  • Multiple sequence alignment: Identify conserved domains, motifs, and potential functional residues.

  • Phylogenetic analysis: Determine evolutionary relationships among ZnT6 proteins.

  • Homology modeling: Generate structural models to compare predicted 3D structures.

Functional comparison approaches:

  • Heterologous expression systems:

    • Express Xenopus and mammalian transporters in the same system (e.g., Xenopus oocytes)

    • Measure transport kinetics under identical conditions

    • Compare parameters like Km, Vmax, ion/substrate specificity

  • Complementation assays:

    • Test ability of different orthologs to rescue phenotypes in knockout models

    • Use zinc-sensitive yeast strains to assess functional complementation

  • Cross-species protein-protein interaction studies:

    • Determine if Xenopus SLC30A6-A can interact with mammalian ZnT5

    • Compare heterodimer formation efficiency

Case study from published research:
The conservation of function among ZnT proteins has been demonstrated in heterologous systems. For example, human and chicken ZnT5-ZnT6 heterodimers show similar abilities to activate tissue-nonspecific alkaline phosphatase (TNAP) when expressed in knockout cell lines . This suggests functional conservation despite sequence differences.

Similarly, ZnT proteins from evolutionary distant species like Caenorhabditis elegans (where ZnT5 and ZnT6 are named Cdf5 and Toc1, respectively) retain functionality when expressed in vertebrate cells , highlighting the conservation of core functional properties.

What are the implications of SLC30A6-A research for understanding zinc-related pathologies and zinc homeostasis mechanisms?

Research on SLC30A6-A has broad implications for understanding zinc homeostasis and related pathologies:

Fundamental zinc homeostasis mechanisms:

  • Compartmentalization of zinc: SLC30A6-A, as part of the ZnT family, contributes to the regulation of zinc levels in cellular compartments, particularly the secretory pathway .

  • Activation of zinc-dependent enzymes: ZnT5-ZnT6 heterodimers are critical for the activation of secretory pathway zinc enzymes like alkaline phosphatases .

  • Evolutionary conservation: Studying Xenopus SLC30A6-A provides insights into conserved zinc homeostasis mechanisms across vertebrates.

Pathological implications:

  • Neurodegenerative diseases: Human ZnT6 has been implicated in Alzheimer's disease pathogenesis, with altered expression in affected brain regions .

  • Developmental disorders: Zinc transporters play crucial roles in development, as evidenced by other family members like ZIP12, which is essential for neurulation in Xenopus .

  • Metabolic dysfunction: Proper zinc distribution is essential for insulin processing and secretion, involving secretory pathway zinc transporters.

Therapeutic perspectives:

  • Drug development targets: Understanding structure-function relationships of zinc transporters may facilitate the design of modulators for therapeutic purposes.

  • Biomarkers: Alterations in zinc transporter expression or function could serve as biomarkers for disease states.

  • Gene therapy approaches: For disorders involving zinc transporter dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.