Recombinant Xenopus laevis Zinc transporter 7-A (slc30a7-a)

Shipped with Ice Packs
In Stock

Description

Functional Role in Zinc Homeostasis

  • Subcellular Localization: Primarily localized to the Golgi apparatus, mediating zinc sequestration into vesicles .

  • Physiological Impact:

    • Regulates cellular zinc distribution, affecting enzymatic activity and signaling pathways .

    • In mammals, ZnT7 deficiency reduces zinc levels in secretory organs (e.g., pancreas, testes) and impairs hormone synthesis (e.g., testosterone, insulin) .

In Vivo and In Vitro Studies

  • Testosterone Synthesis: Mouse studies show ZnT7 colocalizes with steroidogenic enzymes (e.g., StAR, P450scc) in Leydig cells. Knockdown reduces testosterone production by 40–60% .

  • Insulin Secretion: Combined deletion of Slc30a7 and Slc30a8 in mice abolishes glucose-stimulated insulin secretion, highlighting functional redundancy among ZnT transporters .

Xenopus laevis-Specific Insights

  • Isoforms: Two homeologs (slc30a7-a and slc30a7-b) exist due to allotetraploidy in X. laevis, with distinct expression patterns but overlapping roles in zinc transport .

  • Applications: Used in ELISA, Western blot, and immunogen production to study zinc transporter dynamics .

Applications in Scientific Research

ApplicationUse Case
Protein Interaction StudiesIdentified interactions with steroidogenic enzymes and zinc-dependent transcription factors .
Disease ModelingUsed to explore zinc dysregulation in metabolic disorders (e.g., diabetes, hypogonadism) .
Antibody DevelopmentRabbit polyclonal antibodies against slc30a7 enable protein localization studies .

Comparative Analysis with Other ZnT Transporters

FeatureZnT7-A (slc30a7-a)ZnT8 (slc30a8)
Tissue ExpressionUbiquitous (Golgi-enriched)Pancreatic β-cells
Zinc TransportGolgi accumulationInsulin granule loading
Disease LinkTestosterone deficiency Type 2 diabetes susceptibility

Future Directions

  • Mechanistic Studies: Clarify structural determinants of zinc binding/transport using cryo-EM.

  • Therapeutic Targeting: Explore ZnT7-A modulation to address zinc-related metabolic disorders.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize development with the specified tag.
Synonyms
slc30a7-a; znt7-a; Zinc transporter 7-A; ZnT-7-A; Solute carrier family 30 member 7-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc30a7-a
Target Protein Sequence
MLPLSIKDDEYKPPKFNLARKVSGWIRSIFSDSTSRNLFCFLCLNLSFAFVELFYGIWSN SLGLISDSFHMFFDCTALLAGLAASVISRWKTNEAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALDTPEVHHERLLPVSIMGLLVNIIGIFVFQHGGGHGHSHESGHGHSHSLF NGAVSHGHSHGGGHGHSHEGGHGHSHSQGGGHGHSHDHSPKHGYGSSCHDEPPEEHKGSS KQILEGVFLHIVADTLGSVGVIFSTILMQRYGLMIADPICSMLIALLIFVSVIPLLKQSI GILMQRTPPALDHVLPQCYQRVQQLQGVYHLQEPHFWTLCTDVYIGTLKLVIGPEADARW ILSQTHNIFTQAGVRQLYVQIDFAAI
Uniprot No.

Target Background

Function
This protein appears to facilitate zinc transport from the cytoplasm into the Golgi apparatus. It plays a role in regulating cellular zinc homeostasis.
Database Links

KEGG: xla:734474

UniGene: Xl.21065

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is SLC30A7-A and what is its role in Xenopus laevis?

SLC30A7-A (also known as ZnT7-A) is a member of the solute carrier family 30, which functions as a zinc transporter in Xenopus laevis. The full-length protein consists of 386 amino acids and plays a crucial role in zinc homeostasis . Similar to its mammalian counterparts, Xenopus SLC30A7-A likely functions to transport zinc into the Golgi apparatus, contributing to the regulation of intracellular zinc distribution and compartmentalization .

To investigate its function, researchers typically employ techniques such as recombinant protein expression, subcellular localization studies using fluorescent tags, and zinc transport assays. Current evidence from related zinc transporters suggests that SLC30A7-A may be involved in providing zinc to zinc-dependent enzymes during embryonic development, though specific studies in Xenopus are still emerging.

How does zinc transport function in Xenopus laevis development?

Zinc transport in Xenopus laevis follows specific developmental patterns crucial for embryogenesis. During oogenesis, zinc is primarily transported by vitellogenin, which contains approximately 2 g-atoms of zinc per dimer and facilitates zinc distribution within the oocyte . The dynamics of zinc uptake vary by developmental stage: in stage II oocytes, zinc remains in the cytosol after internalization, while in stage IV oocytes, it transfers from the cytosol to yolk platelets within 4 hours .

As development progresses to later stages (V-VI), more than 90% of total oocyte zinc becomes sequestered within yolk platelets, with the remainder in the cytosol . This sequestered zinc remains inaccessible throughout embryo formation until several days after tadpole hatching, while the cytosolic zinc pool serves as the primary source for zinc-dependent processes during embryogenesis .

To study these dynamics, researchers typically employ radioisotope tracing with Zn65, subcellular fractionation, and atomic absorption spectroscopy to quantify zinc in different compartments throughout development.

What experimental models are used to study SLC30A7-A function?

Several experimental models are employed to study SLC30A7-A function:

  • Xenopus oocyte expression system: By microinjecting SLC30A7-A cRNA into oocytes, researchers can measure zinc uptake using radioisotope tracers or zinc-sensitive fluorescent dyes to determine transport kinetics and substrate specificity.

  • Cell culture overexpression: Similar to techniques used with other zinc transporters, stably transfected cell lines (such as LLC-PK1 cells) allow measurement of zinc transport activity by comparing metal content between SLC30A7-A-expressing cells and control cells .

  • CRISPR/Cas9 knockout models: Generating SLC30A7-A-deficient Xenopus embryos enables assessment of developmental consequences of transporter dysfunction.

  • Zinc uptake assays: Time, temperature, and concentration-dependent studies help characterize the kinetic properties of SLC30A7-A, similar to methodologies used for other zinc transporters that demonstrate Michaelis-Menten kinetics .

To generate reliable data, researchers must account for endogenous zinc transport activities by including appropriate controls and performing comparative analyses between wild-type and modified systems.

What methodologies are most effective for studying zinc transport kinetics of recombinant SLC30A7-A?

For rigorous characterization of SLC30A7-A transport kinetics, multiple complementary approaches should be employed:

  • Radioisotope uptake assays: Using 65Zn tracers in recombinant expression systems allows time-course and concentration-dependent measurements. This approach has successfully characterized kinetic parameters of related transporters, revealing Michaelis-Menten kinetics with specific Km and Vmax values .

  • Live-cell imaging with zinc-specific fluorophores: Fluorescent indicators such as FluoZin-3 enable real-time monitoring of zinc uptake and compartmentalization in cells expressing SLC30A7-A .

  • Atomic absorption spectroscopy: This technique provides quantitative measurements of total cellular zinc content, allowing comparison between SLC30A7-A-expressing cells and controls. For example, similar approaches with other transporters have demonstrated approximately 60% higher zinc accumulation in cells expressing zinc transporters compared to control cells .

  • Competition assays: To determine substrate specificity, researchers can perform uptake assays in the presence of various metal ions to identify potential competitive inhibitors.

When analyzing kinetic data, it's essential to account for endogenous transport systems by subtracting control values from experimental measurements. Temperature controls (4°C vs. 37°C) help distinguish between active transport and passive binding .

How does SLC30A7-A interact with other zinc transporters in Xenopus development?

The interplay between SLC30A7-A and other zinc transporters forms a complex regulatory network during Xenopus development:

  • Complementary transport directions: The SLC30 (ZnT) family generally mediates zinc efflux from the cytoplasm, while the SLC39 (ZIP) family facilitates zinc influx. These opposing functions create a balanced system for maintaining optimal cellular zinc concentrations.

  • Compartment-specific functions: Each transporter populates specific subcellular locations, creating a coordinated zinc distribution network. While SLC30A7-A likely localizes to the Golgi apparatus based on mammalian homolog studies , other transporters target different compartments, enabling proper zinc allocation throughout the cell.

  • Developmental regulation: Expression patterns of zinc transporters change throughout embryonic development, suggesting stage-specific roles in zinc homeostasis. This temporal regulation can be studied through techniques such as quantitative PCR, in situ hybridization, and immunohistochemistry at different developmental stages.

  • Functional redundancy and compensation: Research on other zinc transporters suggests potential compensatory mechanisms. For example, when one transporter is dysfunctional, others may be upregulated to maintain zinc homeostasis.

To study these interactions, researchers should consider combinatorial approaches including co-immunoprecipitation studies to identify physical interactions, double knockdown/knockout experiments to assess functional redundancy, and co-expression studies to evaluate synergistic or antagonistic effects.

What mechanisms regulate SLC30A7-A expression during zinc deficiency or excess?

The regulation of SLC30A7-A expression in response to zinc fluctuations likely involves multiple interrelated mechanisms:

  • Transcriptional regulation: Studies of related zinc transporters such as ZnT-1, ZnT-5, and ZnT-7 have demonstrated differential regulation of gene expression in response to zinc levels. Real-time RT-PCR analysis can reveal how SLC30A7-A mRNA levels respond to zinc deficiency or supplementation .

  • Post-translational modifications: Zinc transporters often undergo modifications that affect their trafficking, stability, or activity. These can include phosphorylation, ubiquitination, or glycosylation in response to changing zinc levels.

  • Protein trafficking: Alterations in zinc concentrations may trigger redistribution of SLC30A7-A between cellular compartments. Subcellular fractionation and immunofluorescence microscopy can track these movements under different zinc conditions.

  • Protein-protein interactions: Changes in zinc availability might alter SLC30A7-A's interaction with other proteins, including potential formation of heterooligomers similar to those observed between ZnT5 and ZnT6 in mammals .

  • Feedback loops: Zinc itself can act as a signaling molecule, potentially affecting the transcription factors that regulate SLC30A7-A expression. Chromatin immunoprecipitation (ChIP) assays can identify transcription factors binding to the SLC30A7-A promoter under varying zinc conditions.

Experimental approaches should include zinc depletion (using chelators like EDTA) and zinc supplementation studies, followed by analysis of SLC30A7-A at both mRNA and protein levels.

What analytical challenges exist in determining SLC30A7-A zinc transport efficiency?

Researchers face several analytical challenges when characterizing SLC30A7-A transport activity:

  • Distinguishing endogenous vs. recombinant transport: Cells possess native zinc transport systems that can mask the activity of recombinant SLC30A7-A. This requires careful experimental design with appropriate controls and mathematical subtraction of background transport. For example, with other zinc transporters, researchers have estimated recombinant transporter contribution by subtracting vector control values from values observed in transporter-expressing cells .

  • Controlling for surface-bound zinc: During uptake studies, zinc can adhere to cell surfaces rather than being transported. More stringent washing protocols (e.g., using 1 mM EDTA) can help remove surface-bound zinc to obtain more accurate measurements of transported zinc .

  • Temporal resolution limitations: Zinc transport can occur rapidly, making it challenging to capture initial rate kinetics. Stopped-flow techniques and rapid sampling methods can help overcome this limitation.

  • Distinguishing between transport and binding: Zinc may bind to SLC30A7-A without being transported. Temperature-dependent studies (comparing 4°C vs. 37°C conditions) can help differentiate between binding and transport, as transport is typically minimal at 4°C while binding may still occur .

  • Accounting for microenvironment effects: The protein's environment significantly impacts its transport properties. Studies of related transporters have shown that kinetic parameters can differ by up to 50-fold depending on whether the protein is studied in proteoliposomes or cellular systems .

To address these challenges, researchers should employ multiple complementary techniques and include appropriate controls to allow for accurate interpretation of results.

How can recombinant SLC30A7-A be optimally expressed and purified for functional studies?

Optimal expression and purification of recombinant Xenopus laevis SLC30A7-A requires careful consideration of expression systems, tags, and purification strategies:

  • Expression systems:

    • E. coli: Provides high yield but may present challenges for proper folding of membrane proteins. Nevertheless, E. coli has been successfully used to produce recombinant full-length Xenopus laevis SLC30A7-A with His-tagging .

    • Insect cells: Baculovirus expression systems offer improved post-translational modifications and membrane protein folding compared to bacterial systems.

    • Mammalian cells: Provide native-like membrane environment and post-translational modifications, although with typically lower yields.

  • Affinity tags and fusion partners:

    • His-tag: A 6×His tag is commonly used for recombinant SLC30A7-A purification via immobilized metal affinity chromatography (IMAC) .

    • GST or MBP fusion: These larger tags can improve solubility but may affect transporter function and require tag removal.

    • Tag position: N- or C-terminal placement should be optimized, as improper placement may interfere with folding or function.

  • Detergent selection: Critical for membrane protein extraction and stability. Common detergents include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), and digitonin, which should be screened for optimal SLC30A7-A solubilization and activity preservation.

  • Purification protocol optimization:

    • Initial extraction should be performed at 4°C to minimize proteolysis

    • Multiple chromatography steps (IMAC followed by size exclusion) improve purity

    • Including zinc or other stabilizing agents in buffers may enhance protein stability

  • Functional validation: Following purification, functionality should be assessed through reconstitution into proteoliposomes and measurement of zinc transport activity, comparing kinetic parameters with those obtained in cellular systems to account for environmental effects on transporter function .

What assays can differentiate between SLC30A7-A and other zinc transporters in Xenopus laevis?

Distinguishing SLC30A7-A activity from other zinc transporters requires specifically designed assays:

How can transgenerational effects of zinc transporter dysfunction be studied in Xenopus models?

Investigating transgenerational effects of zinc transporter dysfunction in Xenopus requires a carefully designed experimental approach:

  • Multi-generational experimental design:

    • F0 exposure: Expose embryos to zinc deficiency or excess, or manipulate SLC30A7-A expression through morpholinos or CRISPR/Cas9.

    • F1 assessment: Evaluate offspring from F0 exposed animals, with and without additional challenges.

    • F2 and beyond: Continue breeding to assess persistence of effects across generations.

This approach is similar to transgenerational studies in zebrafish, where early life exposure to zinc (10 μM) demonstrated effects spanning multiple generations, including delayed hatching and altered zinc homeostasis .

  • Key parameters to assess across generations:

    • Developmental timing: Monitor hatching rates and developmental milestones.

    • Metal homeostasis: Measure zinc, selenium, and other metals in tissues across generations using atomic absorption spectroscopy or ICP-MS.

    • Gene expression: Analyze expression of zinc transporters and zinc-dependent genes using qPCR.

    • Sex ratios: Evaluate potential effects on sex determination, as zinc exposure has been shown to skew sex ratios in fish .

    • Response to challenges: Test resilience by exposing subsequent generations to zinc deficiency or excess.

  • Epigenetic analysis:

    • DNA methylation profiling of SLC30A7-A and related genes

    • Histone modification analysis in promoter regions

    • Small RNA sequencing to identify potential transgenerational regulators

This multi-faceted approach would provide insights into whether early life dysfunction of SLC30A7-A creates a "zinc memory" that persists across generations, similar to observations in zebrafish where embryonic zinc exposure affected not only the exposed fish but also their offspring .

What strategies can resolve contradictory data on SLC30A7-A function in different experimental systems?

When faced with contradictory results regarding SLC30A7-A function across different experimental systems, researchers should implement the following strategies:

  • Standardization of experimental conditions:

    • Establish consistent zinc concentrations in culture media

    • Standardize expression levels of recombinant SLC30A7-A

    • Control for cell density, passage number, and growth conditions

    • Develop standard operating procedures for zinc transport assays

  • System-specific calibration:

    • Recognize that kinetic parameters (e.g., Km, Vmax) may vary substantially between systems due to microenvironment differences. For example, research on related transporters has shown 50-fold differences in kinetic constants between proteoliposome and cellular systems .

    • Develop correction factors based on well-characterized control proteins tested across systems.

  • Comprehensive characterization across models:

    Experimental SystemAdvantagesLimitationsRecommended Controls
    Xenopus oocytesNative amphibian system, low backgroundLimited subcellular resolutionWater-injected oocytes
    Mammalian cell linesWell-characterized, easy to manipulateNon-amphibian environmentEmpty vector transfection
    In vitro reconstitutionDefined componentsLacks cellular complexityProtein-free liposomes
    Xenopus embryosTrue developmental contextComplex system with multiple transportersMorpholino controls
  • Integration of multiple approaches:

    • Triangulate findings using complementary techniques (radioisotope uptake, fluorescent indicators, atomic absorption)

    • Confirm protein expression and localization in parallel with functional assays

    • Validate key findings across at least two independent systems

  • Context-dependent interpretation:

    • Consider that apparent contradictions may reflect genuine biological differences between systems rather than experimental artifacts

    • Explore whether SLC30A7-A function varies with developmental stage, tissue type, or zinc status

By systematically addressing these aspects, researchers can resolve apparent contradictions and develop a more nuanced understanding of SLC30A7-A function across different experimental contexts.

How can SLC30A7-A research inform developmental biology of zinc-dependent processes?

Research on SLC30A7-A provides unique insights into zinc-dependent developmental processes in vertebrates:

  • Zinc distribution during embryogenesis: Understanding SLC30A7-A's role in compartmentalizing zinc during Xenopus development illuminates how embryos regulate access to this essential micronutrient. Studies in Xenopus have shown that zinc is dynamically redistributed during oogenesis and early development, with distinct pools serving different functions .

  • Temporal regulation of zinc availability: SLC30A7-A likely contributes to the precise timing of zinc availability for developmental processes. Research indicates that in Xenopus, zinc remains sequestered in yolk platelets throughout embryo formation, with redistribution to the cytosol beginning only after tadpole hatching . This suggests a carefully regulated process that SLC30A7-A may help orchestrate.

  • Enzyme activation during differentiation: Given that mammalian ZnT7 is required for the activation of alkaline phosphatases and other zinc-dependent enzymes , studying SLC30A7-A can reveal how zinc-requiring enzymatic processes are regulated during tissue differentiation in Xenopus.

  • Metal cross-talk in development: Research into zinc transporters provides insights into how different metals interact during development. For instance, zinc exposure in fish affects not only zinc homeostasis but also that of selenium and manganese , suggesting complex regulatory networks that may be similar in Xenopus.

  • Evolutionary conservation of zinc regulation: Comparative studies between Xenopus SLC30A7-A and transporters in other species can illuminate evolutionarily conserved mechanisms of zinc regulation in development. This approach can identify core zinc-dependent processes essential across vertebrates versus species-specific adaptations.

To advance this field, researchers should employ technologies such as cell-type specific knockout of SLC30A7-A, real-time imaging of zinc dynamics during development, and multi-omics approaches to identify downstream targets affected by SLC30A7-A dysfunction.

What comparative approaches between Xenopus and mammalian zinc transporters yield the most valuable insights?

Comparative studies between Xenopus SLC30A7-A and mammalian counterparts offer significant research opportunities:

  • Sequence and structural homology analysis:

    • Multiple sequence alignment of SLC30A7 proteins across species reveals conserved domains crucial for function, similar to approaches used with ZIP family transporters that identified conserved regions in transmembrane domains VII-IX .

    • Homology modeling based on available structural data can predict functional motifs specific to amphibian transporters versus mammals.

  • Functional complementation studies:

    • Expressing Xenopus SLC30A7-A in mammalian cells with knocked-out endogenous ZnT7 can determine functional conservation.

    • Creating chimeric proteins combining domains from Xenopus and mammalian transporters helps identify species-specific functional regions.

  • Developmental expression pattern comparison:

    • Parallel analysis of expression timing and tissue distribution between species can reveal evolutionary adaptations in zinc regulation.

    • This approach has particular relevance given the differences in developmental strategies between mammals and amphibians.

  • Heterooligomerization potential:

    • Investigation of whether Xenopus SLC30A7-A forms heterooligomers with other transporters, as observed with mammalian ZnT5 and ZnT6 , can reveal conserved or divergent protein interaction networks.

  • Environmental adaptability:

    • Comparing how Xenopus and mammalian transporters respond to environmental zinc fluctuations may reveal adaptations specific to aquatic versus terrestrial lifestyles.

  • Substrate specificity profiling:

    • Systematic testing of metal transport capabilities between Xenopus and mammalian transporters can identify evolutionary shifts in transporter function.

These comparative approaches should employ standardized experimental systems where both Xenopus and mammalian proteins are tested under identical conditions to ensure valid comparisons.

How can SLC30A7-A research contribute to understanding zinc-related pathologies?

Research on Xenopus SLC30A7-A offers valuable insights for understanding zinc-related pathologies in humans:

  • Developmental disorders: Given zinc's essential role in embryogenesis, dysregulation of zinc transport during development may contribute to congenital abnormalities. Studies in Xenopus provide a model to investigate these connections, particularly since zinc exposure affects developmental timing and metal homeostasis across generations .

  • Neurodevelopmental conditions: Zinc is crucial for proper brain development and function. Research has shown that zinc exposure affects brain metal homeostasis in fish , suggesting that SLC30A7-A studies in Xenopus could provide insights into the role of zinc transport in neurodevelopmental conditions.

  • Immunological dysfunction: Zinc transporters like SLC39A8 (ZIP8) regulate inflammatory responses through zinc-mediated mechanisms . By understanding the parallel roles of SLC30A7-A in amphibian immune function, researchers can identify conserved zinc-dependent immune regulatory pathways relevant to human inflammatory conditions.

  • Transgenerational effects: Research in zebrafish has demonstrated that early-life zinc exposure creates effects that persist across generations . Similar studies with SLC30A7-A in Xenopus could illuminate mechanisms of environmentally induced transgenerational epigenetic inheritance relevant to human health.

  • Cancer biology: Dysregulation of zinc homeostasis has been implicated in cancer. For example, studies have revealed deregulation of zinc homeostasis and associated genes in esophageal squamous cell carcinoma . SLC30A7-A research in Xenopus can help identify fundamental mechanisms of zinc-related carcinogenesis.

Translational approaches should include developing Xenopus disease models with SLC30A7-A mutations corresponding to human zinc transporter variants associated with pathologies, allowing for rapid screening of potential therapeutic interventions targeting zinc transport pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.