Recombinant Xenopus laevis Zinc transporter 7-B (slc30a7-b)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Identity

  • Gene Name: slc30a7-b (zinc transporter 7-B, ZnT-7-B)

  • Protein Name: Zinc transporter 7-B (ZnT-7-B)

  • Synonyms: znt7-b, solute carrier family 30 member 7-B

  • Species: Xenopus laevis (African clawed frog)

  • UniProt ID: Q6NRI1

Zinc Transport Mechanism

slc30a7-b belongs to the cation diffusion facilitator (CDF) superfamily, primarily mediating zinc efflux from the cytoplasm into organelles like the Golgi apparatus . This isoform regulates intracellular zinc distribution, influencing processes such as protein synthesis, signaling, and immune function .

Functional Redundancy with slc30a7-a

The slc30a7 gene generates two isoforms (A and B) via alternative splicing or genomic duplication. In Xenopus, these are designated as:

  • S homeolog: slc30a7-a (short isoform)

  • L homeolog: slc30a7-b (long isoform)
    Studies in pancreatic islets suggest that ZnT7 (slc30a7) compensates for ZnT8 (slc30a8) activity, with combined deletion abolishing glucose-stimulated insulin secretion .

Experimental Uses

  1. Zinc Homeostasis Studies:

    • Investigating zinc compartmentalization in the Golgi apparatus .

    • Modeling zinc-related diseases (e.g., diabetes, immunodeficiencies) .

  2. Immunological Research:

    • ELISA detection of slc30a7-b expression in Xenopus or other species .

    • Western blot validation of zinc transporter activity in cell lysates .

  3. Therapeutic Targeting:

    • Screening inhibitors/activators of zinc transport for disease intervention .

Key Findings from Related Studies

Study FocusKey DiscoveryRelevance to slc30a7-b
Pancreatic Islet FunctionCombined slc30a7/slc30a8 deletion abolishes insulin secretion Highlights functional redundancy in zinc transport
B Cell DevelopmentZIP7 (SLC39A7) mutations cause agammaglobulinemia due to ER zinc dyshomeostasis Parallels with slc30a7's role in organelle zinc regulation
Macrophage ImmunitySlc30a1 (ZnT1) regulates zinc export and nitric oxide production Supports broader roles of SLC30 transporters in immune function

Comparative Analysis with slc30a7-a

Parameterslc30a7-aslc30a7-b
Genomic OriginS homeolog (short) L homeolog (long)
Tissue ExpressionBroad (pancreas, liver) Tissue-specific (e.g., immune cells?)
Functional SpecializationGeneral zinc transport Specialized organelle targeting

Challenges and Future Directions

  • Isoform-Specific Functions: Limited data on slc30a7-b’s unique roles compared to slc30a7-a.

  • Therapeutic Potential: Requires in vivo studies to validate zinc transport modulation in disease models.

  • Evolutionary Insights: Comparative studies in teleosts (e.g., Xenopus) may reveal conserved mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
slc30a7-b; znt7-b; Zinc transporter 7-B; ZnT-7-B; Solute carrier family 30 member 7-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc30a7-b
Target Protein Sequence
MLPLSIKDDEYKPPKFNLVRKVSGWIRSIFSDSTSRNLFCFLCLNLSFAFVELFYGIWSN SLGLISDSFHMFFDCTALLAGLAASVISRWKTNETFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGIERALDTPEVHHERLLPVSIMGFLVNLIGIFVFQHGGGHGHSHESGHGHSHSLF NGAVSHGHSHSHGGGHGHSHGGGHEHGHSHGGGHEHGHDHSHKHGHGYGSSCHDEPPEEN KGSSKQILEGVFLHIVADALGSVGVIISTILMQQYGLMIADPICSMLIALLIFVSVIPLL KQSIGILMQRTPPSLDHVLPQCYQRVQQLQGVYHLQEPHFWTLCTDVYIGTLKLVIGPEA DARWILSQTHNIFTQAGVRQLYVQIDLAAM
Uniprot No.

Target Background

Function
Facilitates zinc transport from the cytoplasm to the Golgi apparatus and plays a role in regulating cellular zinc homeostasis.
Database Links

KEGG: xla:431904

UniGene: Xl.71826

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is the function and significance of SLC30A7 (ZnT7) in Xenopus laevis?

Zinc transporter 7-B (slc30a7-b) in Xenopus laevis belongs to the Zinc Transporter (ZnT) family encoded by SLC30A genes, which play a crucial role in zinc homeostasis . Like other ZnT family members, slc30a7-b functions as an efflux transporter responsible for removing excess zinc from the cytoplasm and transporting it into intracellular compartments or out of the cell . This protein is critical for maintaining appropriate zinc levels, as zinc is an essential micronutrient involved in numerous biological processes, including enzyme function, protein folding, and signal transduction .

In comparative studies with mammalian systems, ZnT transporters have been shown to work against concentration gradients, particularly when exporting zinc into secretory granules . This suggests that Xenopus slc30a7-b may play a specialized role in zinc compartmentalization during development and in adult tissues. Mutations in SLC30A7 have been associated with pathological conditions in humans, indicating the physiological importance of this transporter across species .

How is the structure of Xenopus laevis slc30a7-b organized?

Based on structural studies of zinc transporters, Xenopus laevis slc30a7-b likely exhibits the characteristic structure of the ZnT family, consisting of a transmembrane domain (TMD) and a cytoplasmic domain (CTD) . The protein functions as a dimer, with two identical protein molecules working together to facilitate zinc transport . The transmembrane region typically contains six transmembrane helices, with the TM3-TM6 helices forming an extensive dimeric interface .

The protein likely contains a zinc-binding site with tetrahedral coordination geometry within the transmembrane domain, which is essential for selective zinc transport . This binding site provides selectivity for zinc over other divalent metal ions through specific coordination chemistry. Unlike ZIP transporters that have more fluidic coordination environments, ZnT transporters typically have a more rigid tetrahedral transport site that contributes to their greater zinc selectivity .

What developmental expression patterns does slc30a7-b exhibit in Xenopus laevis?

While specific expression data for slc30a7-b is not directly addressed in the search results, developmental expression patterns in Xenopus can be studied using similar approaches to those used for other genes. Based on research methodologies for studying gene expression in Xenopus, researchers typically employ:

  • RT-PCR and qPCR to quantify mRNA expression across developmental stages

  • In situ hybridization to visualize spatial expression patterns

  • Immunohistochemistry using specific antibodies to detect protein localization

Expression patterns of zinc transporters often correlate with tissues that have high zinc requirements, such as secretory cells or tissues involved in zinc storage or detoxification. In Xenopus tadpoles and adult frogs, expression may differ significantly as the organism undergoes metamorphosis, similar to how MHC Class I molecules show stage-specific expression patterns .

How does slc30a7-b compare to mammalian zinc transporters?

Xenopus laevis slc30a7-b shares fundamental mechanistic features with mammalian zinc transporters, but may exhibit species-specific adaptations. Both belong to the CDF (Cation Diffusion Facilitator) family, of which ZnT transporters are members . While mammalian ZnT7 (encoded by SLC30A7) has been studied more extensively, the Xenopus ortholog likely maintains the core transport mechanism.

Key comparisons include:

FeatureMammalian ZnT TransportersXenopus laevis slc30a7-b
Transport directionEfflux (cytoplasm to organelles/outside)Likely similar efflux function
Oligomeric stateDimericLikely dimeric based on conservation
Transport mechanismAlternating access mechanismProbably conserved mechanism
RegulationSelf-regulating with zinc sensor capabilitiesMay have similar regulatory features
Metal selectivityHigh specificity for Zn(II)Likely selective for zinc over other metals

The degree of functional conservation between mammalian and amphibian zinc transporters provides valuable insights into the evolutionary significance of zinc homeostasis mechanisms across vertebrate species .

What expression systems are most effective for recombinant Xenopus laevis slc30a7-b production?

For recombinant expression of membrane proteins like slc30a7-b, several expression systems can be considered, each with specific advantages:

  • Bacterial expression systems: While cost-effective and scalable, they often struggle with proper folding of eukaryotic membrane proteins. If attempted, specialized E. coli strains (C41, C43) engineered for membrane protein expression should be used along with fusion tags to enhance solubility.

  • Yeast expression systems: Pichia pastoris or Saccharomyces cerevisiae provide eukaryotic folding machinery while remaining relatively simple to work with. These systems have been successful for various zinc transporters and would be appropriate for slc30a7-b .

  • Insect cell expression: Baculovirus-infected Sf9 or High Five cells offer improved post-translational processing and membrane insertion, making them suitable for functional studies of zinc transporters.

  • Mammalian cell expression: HEK293 or CHO cells provide the most native-like environment for proper folding and modification but at higher cost and complexity .

For crystallographic or cryo-EM structural studies, expression constructs should include purification tags (His6, FLAG, or Strep-tag) and potentially stability-enhancing mutations based on computational analysis .

What purification strategies yield the highest quality recombinant slc30a7-b protein?

Purification of recombinant slc30a7-b requires specialized approaches due to its hydrophobic nature as a membrane protein:

  • Membrane preparation: After expression, cells should be disrupted by sonication or mechanical homogenization, followed by differential centrifugation to isolate membrane fractions.

  • Solubilization: Critical for membrane protein purification, this step requires screening different detergents (DDM, LMNG, GDN) or amphipols to find optimal solubilization conditions that maintain native protein conformation.

  • Affinity chromatography: Using engineered affinity tags (His6, FLAG) for initial capture, followed by size exclusion chromatography to isolate properly folded dimeric complexes .

  • Quality assessment: Employ techniques like SDS-PAGE, Western blotting, dynamic light scattering, and thermal stability assays to confirm protein quality before functional studies.

For structural studies, stability can be enhanced by adding zinc during purification, as it has been shown to stabilize zinc transporters in their native conformations . Additionally, nanodiscs or lipid cubic phase reconstitution may better preserve protein function for downstream analyses.

What methods effectively measure zinc transport activity of recombinant slc30a7-b?

Several complementary approaches can be employed to characterize the zinc transport function of recombinant slc30a7-b:

  • Reconstituted proteoliposome assays: By incorporating purified protein into artificial liposomes, researchers can directly measure zinc uptake/efflux using:

    • Radioisotope (65Zn) flux measurements

    • Zinc-sensitive fluorescent probes (FluoZin-3, Zinpyr-1)

    • ICP-MS analysis to quantify zinc movement across membranes

  • Cellular zinc imaging: Expression in zinc-deficient cellular models followed by:

    • Fluorescent zinc indicators to visualize subcellular zinc distribution

    • Genetically encoded zinc sensors (eCALWY probes) for real-time monitoring

  • Electrophysiological approaches: For characterizing transport kinetics:

    • Two-electrode voltage clamp in Xenopus oocytes expressing slc30a7-b

    • Patch-clamp recordings to measure transport-associated currents

  • Zinc-dependent growth complementation: Expression in zinc-sensitive yeast mutants to assess functional complementation .

These methodologies allow researchers to determine transport direction, kinetics, substrate specificity, and regulatory mechanisms governing slc30a7-b activity.

How can CRISPR/Cas9 gene editing be applied to study slc30a7-b function in Xenopus laevis?

CRISPR/Cas9 technology can be powerfully applied to study slc30a7-b function in Xenopus laevis through several approaches:

  • Guide RNA design: Design specific sgRNAs targeting conserved regions of the slc30a7-b gene. Multiple guide RNAs may be necessary due to the pseudotetraploid nature of Xenopus laevis .

  • Delivery method:

    • Microinjection of Cas9 protein and sgRNA into fertilized Xenopus eggs

    • Alternatively, injection of in vitro-transcribed Cas9 mRNA and sgRNA

  • Verification of gene editing:

    • DNA extraction from embryos/tadpoles followed by PCR amplification of the target region

    • DNA sequencing to confirm successful knockout or mutation introduction

    • T7 endonuclease assay or TIDE analysis to estimate editing efficiency

  • Phenotypic analysis:

    • Monitoring development of transgenic tadpoles for morphological abnormalities

    • Assessing zinc levels in various tissues using zinc-specific staining or analytical methods

    • Examining expression of zinc-dependent proteins and processes

  • Rescue experiments: Reintroducing wild-type or mutant slc30a7-b to confirm specificity of observed phenotypes.

This approach has been successfully employed for other genes in Xenopus laevis, such as MHC Class I, where CRISPR/Cas9 editing allowed researchers to determine protein function during development .

How does zinc transport regulation in slc30a7-b compare with other zinc transporters?

Zinc transport regulation in slc30a7-b likely involves multiple mechanisms similar to other zinc transporters, though with potential unique features:

  • Autoregulatory mechanisms: Recent structural studies of zinc transporters revealed built-in self-regulating sensors that respond to intracellular zinc concentrations . When zinc levels inside the cell rise beyond physiological requirements, excess zinc binds to a flexible loop on the cytoplasmic side of the membrane, causing conformational changes that block further zinc entry . This "plug" mechanism may be conserved in slc30a7-b.

  • Conformational switching: Transport likely involves alternating between inward-facing and outward-facing states in response to zinc binding, similar to bacterial homologs like YiiP . This conformational switch appears to be triggered by an allosteric mechanism connecting the cytoplasmic domain to the transmembrane domain through zinc-dependent reorientation of specific transmembrane helices .

  • Dimeric interactions: As a dimeric protein, slc30a7-b function may depend on cooperative interactions between the two subunits, as observed in other zinc transporters . These interactions could provide additional regulatory control over transport activity.

Unlike bacterial transporters that primarily export excess zinc, eukaryotic zinc transporters like slc30a7-b must work against concentration gradients when exporting into secretory granules . This functional difference may be reflected in distinct regulatory mechanisms that have evolved to meet the specialized needs of compartmentalized eukaryotic cells.

What roles might slc30a7-b play in Xenopus immune function and development?

While direct evidence for slc30a7-b's role in Xenopus immune function is not provided in the search results, several connections can be inferred:

  • Developmental immune regulation: In Xenopus laevis, immune system components show stage-specific expression patterns, similar to how MHC Class I molecules are active in adult frogs but undetectable in tadpoles despite being immunocompetent . Zinc transporters like slc30a7-b may similarly exhibit developmental regulation that impacts immune function.

  • Zinc-dependent immune processes: Zinc is critical for immune cell development and function across species. As a regulator of zinc availability, slc30a7-b likely influences:

    • Lymphocyte development and activation

    • Cytokine production and signaling

    • Antigen presentation pathways

  • Comparative immunology insights: Given that mutations in human SLC39A7 (ZIP7) cause immunodeficiency syndromes with reduced B cell signaling , the Xenopus slc30a7-b may serve analogous functions in amphibian immune development.

  • Metamorphosis-associated remodeling: During Xenopus metamorphosis, extensive tissue remodeling occurs, including immune system reorganization. Zinc homeostasis mediated by slc30a7-b may be critical during this transition period.

Research approaches to investigate these connections include:

  • Temporal expression analysis across developmental stages

  • Tissue-specific knockout studies using CRISPR/Cas9

  • Zinc imaging in immune tissues following slc30a7-b manipulation

  • Immune challenge studies in slc30a7-b-deficient animals

What structural dynamics govern the zinc transport mechanism in slc30a7-b?

The structural dynamics of zinc transport in slc30a7-b likely follow mechanisms similar to those observed in other zinc transporters, with species-specific adaptations:

  • Alternating access mechanism: Based on studies of zinc transporters like YiiP, slc30a7-b likely undergoes conformational changes between inward-facing and outward-facing states to facilitate zinc transport across the membrane . This conformational switch is triggered by an allosteric mechanism connecting the cytoplasmic domain to the transmembrane domain through zinc-dependent reorientation of specific transmembrane helices .

  • Rocking-bundle mechanism: Studies of the inward-facing state of YiiP suggest that motion of a four-helix bundle relative to a static TM3-TM6 scaffold is sufficient to allow zinc transport without breaking the dimer interface . Molecular dynamics simulations have shown that these conformational motions occur upon zinc binding to the transport site .

  • Transport site coordination: The transport site likely involves tetrahedral coordination of zinc, providing selectivity for zinc over other metal ions . This selectivity is achieved through specific amino acid residues that create the optimal coordination geometry for zinc binding.

  • Regulatory conformational changes: Recent structural studies revealed that zinc transporters can undergo self-regulation through zinc-dependent conformational changes . When intracellular zinc levels rise too high, zinc binds to a flexible loop on the cytoplasmic side, causing it to fold back on itself and block further zinc entry—a mechanism described as being similar to "a plug going into a bathtub drain" .

Advanced methods like cryo-electron microscopy have been instrumental in elucidating these structural dynamics in zinc transporters, capturing different conformational states and revealing the molecular mechanisms of transport and regulation .

How do mutations in slc30a7-b affect zinc homeostasis in Xenopus model systems?

Investigating the effects of mutations in slc30a7-b provides valuable insights into zinc homeostasis mechanisms in Xenopus:

  • Key residues for investigation:

    • Residues in the zinc-binding site within the transmembrane domain

    • Amino acids in the cytoplasmic loop involved in autoregulation

    • Interface residues important for dimerization

    • Residues that coordinate the conformational changes during transport

  • Expected phenotypes from mutations:

    • Disruption of zinc transport capability leading to cellular zinc imbalance

    • Developmental abnormalities in zinc-dependent processes

    • Altered response to zinc stress (deficiency or excess)

    • Potential compensation by other zinc transporters

  • Experimental approaches:

    • CRISPR/Cas9-mediated introduction of specific mutations

    • Zinc imaging to assess subcellular zinc distribution

    • Transcriptomic analysis to identify compensatory mechanisms

    • Phenotypic characterization across developmental stages

  • Mechanistic insights:

    • Structure-function relationships through correlation of mutation location with phenotype severity

    • Identification of critical domains for transport versus regulatory functions

    • Comparative analysis with human disease-causing mutations in SLC30A7

This research direction is particularly important as mutations in human zinc transporters are associated with various pathological conditions , making the Xenopus model valuable for understanding fundamental mechanisms of zinc transport and homeostasis.

How does Xenopus laevis slc30a7-b compare functionally to its mammalian orthologs?

Comparative analysis between Xenopus laevis slc30a7-b and its mammalian counterparts reveals important evolutionary insights:

  • Functional conservation: The fundamental zinc transport mechanism is likely conserved across vertebrates, with both Xenopus and mammalian ZnT7 functioning as efflux transporters that move zinc from the cytoplasm into intracellular compartments . This conservation reflects the essential nature of zinc homeostasis across evolutionary diverse organisms.

  • Structural differences: While the core structure is conserved, subtle differences may exist in:

    • The cytoplasmic domain, which may have evolved species-specific regulatory interactions

    • The zinc-binding site, potentially tuned to the specific physiological zinc concentrations in amphibian cells

    • Dimer interface residues that could affect stability and conformational dynamics

  • Regulatory adaptations: The regulatory mechanisms may differ between species. As noted for YiiP versus ZnT8, "different CDF members might adopt different mechanisms for zinc transport," reflecting "distinct transport mechanisms and environmental conditions in which the two proteins operate" . Similar differences may exist between amphibian and mammalian ZnT7.

  • Physiological context: Unlike bacterial transporters that export excess zinc, eukaryotic transporters must work against concentration gradients when exporting into secretory granules . The specific adaptations in Xenopus slc30a7-b may reflect the unique zinc demands of amphibian physiology.

Studying these similarities and differences provides valuable insights into the evolutionary conservation and diversification of zinc transport mechanisms across vertebrate species.

What experimental systems best model the in vivo function of slc30a7-b?

Several experimental systems can be employed to effectively model the in vivo function of slc30a7-b:

  • Xenopus embryos and tadpoles:

    • Direct manipulation of endogenous slc30a7-b using CRISPR/Cas9

    • Overexpression studies via mRNA microinjection

    • Morpholino knockdown for transient suppression

    • Advantages: native cellular environment, developmental context

  • Xenopus oocytes:

    • Heterologous expression system for electrophysiological studies

    • Two-electrode voltage clamp recordings to measure transport activity

    • Advantages: large size, minimal endogenous transport activity

  • Mammalian cell culture models:

    • Expression in zinc transporter-deficient cell lines

    • Fluorescent zinc sensors to monitor transport activity

    • HEK293T cells for protein-protein interaction studies

    • Advantages: controlled environment, well-established tools

  • Reconstitution systems:

    • Proteoliposomes for direct measurement of transport activity

    • Nanodiscs for structural and biophysical studies

    • Advantages: defined composition, isolated function

  • Comparison matrix of experimental systems:

SystemAdvantagesLimitationsBest Applications
Xenopus embryosNative context, developmental studiesComplex systemPhysiological relevance, developmental roles
Xenopus oocytesElectrophysiology, large sizeLimited biochemistryTransport kinetics, electrophysiology
Mammalian cellsWell-characterized, good for biochemistryNon-native environmentProtein interactions, subcellular localization
ProteoliposomesDefined system, direct transportNon-native lipidsPure transport function, substrate specificity

The choice of experimental system should be guided by the specific research question, with multiple complementary approaches often providing the most comprehensive understanding.

What are the most significant unresolved questions about slc30a7-b function?

Despite advances in understanding zinc transporters, several critical questions about slc30a7-b remain unresolved:

  • Developmental regulation: How is slc30a7-b expression and activity regulated during the distinct developmental stages of Xenopus laevis, particularly during metamorphosis when extensive tissue remodeling occurs?

  • Subcellular localization and trafficking: What cellular mechanisms determine the specific subcellular targeting of slc30a7-b, and how does this change in response to zinc status or developmental signals?

  • Interactome network: What proteins interact with slc30a7-b to regulate its function, stability, and localization in Xenopus cells? Do these differ from mammalian interaction networks?

  • Compensatory mechanisms: How do other zinc transporters compensate when slc30a7-b function is compromised, and what is the hierarchical relationship between different transporters?

  • Evolutionary adaptations: What specific adaptations in slc30a7-b structure and function reflect the unique physiological requirements of amphibian zinc homeostasis?

  • Regulatory sensor mechanism: Does slc30a7-b possess a self-regulating zinc sensor similar to that observed in other zinc transporters , and what are the molecular details of this mechanism?

Addressing these questions will require integrated approaches combining structural biology, developmental biology, and functional genomics, ideally utilizing the advantages of the Xenopus model system for both cellular and developmental studies.

How might advances in cryo-EM technology impact our understanding of slc30a7-b structure and function?

Recent advances in cryo-electron microscopy (cryo-EM) offer transformative potential for understanding slc30a7-b structure and function:

  • Structural determination without crystallization: Cryo-EM eliminates the need for protein crystallization, which has traditionally been a major bottleneck for membrane protein structural studies . This advantage is particularly relevant for slc30a7-b, as zinc transporters have historically been challenging to crystallize.

  • Capturing multiple conformational states: Cryo-EM can capture proteins in different conformational states within the same sample, allowing visualization of the transport cycle and regulatory changes . For slc30a7-b, this could reveal the structural transitions between inward-facing and outward-facing states, as well as zinc-dependent regulatory conformations.

  • Visualization of protein complexes: The ability to resolve structures of protein complexes without requiring crystallization makes cryo-EM ideal for studying how slc30a7-b interacts with regulatory partners or forms oligomeric assemblies.

  • Structural basis for regulation: Cryo-EM has already revealed how zinc transporters can self-regulate through zinc-dependent conformational changes, showing "how interactions with zinc on either side of the cellular membrane trigger the movement of parts of the protein" . Similar studies with slc30a7-b could uncover its specific regulatory mechanisms.

  • Structure-guided mutagenesis: High-resolution structures obtained through cryo-EM can guide targeted mutagenesis experiments to probe the functional significance of specific residues and domains in slc30a7-b.

The recent cryo-EM study revealing the built-in self-regulating sensor in a zinc transporter demonstrates the power of this approach for understanding the molecular mechanisms of zinc transport and regulation . Similar approaches applied to slc30a7-b would provide unprecedented insights into its structure, function, and regulation in the context of Xenopus laevis biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.