Recombinant Xenopus laevis Zinc transporter 8 (slc30a8)

Shipped with Ice Packs
In Stock

Description

Introduction to Zinc Transporter 8 (ZnT8) in Xenopus laevis

Zinc Transporter 8 (ZnT8), encoded by the slc30a8 gene in Xenopus laevis, is a member of the solute carrier family 30 (SLC30A) that facilitates zinc efflux from the cytosol into intracellular vesicles. ZnT8 is critical for maintaining zinc homeostasis, particularly in insulin-secreting cells, where it supports zinc accumulation in secretory granules for insulin hexamer stabilization . Recombinant Xenopus laevis ZnT8 enables functional and structural studies to elucidate its role in zinc transport and metabolic diseases like diabetes.

Molecular Characterization of Recombinant Xenopus laevis ZnT8

Recombinant Xenopus laevis ZnT8 is produced through heterologous expression systems such as E. coli, yeast, or mammalian cells. Key features include:

PropertyDetails
Gene IDslc30a8 (L homeolog)
Protein RefseqNP_001090247.1
IsoformsPartial and full-length variants
Molecular Weight~28–68 kDa (varies by isoform and expression system)
Purity>85% (determined by SDS-PAGE)
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free expression
TagHis-tag, Myc-tag, or untagged options

This protein retains structural and functional homology with human ZnT8, including conserved transmembrane domains critical for zinc transport .

Functional Studies in Xenopus laevis Oocytes

Xenopus laevis oocytes are a key model for studying ZnT8 due to their low endogenous transporter activity and capacity for high-yield protein expression .

Key Findings:

  1. Subcellular Localization:

    • Recombinant Xenopus ZnT8 localizes to the plasma membrane and intracellular vesicles in oocytes, enabling direct measurement of zinc efflux .

    • Immunofluorescence and biotinylation assays confirmed surface expression, critical for transport assays .

  2. Zinc Transport Activity:

    • Radiotracer studies using 65Zn^{65}\text{Zn} demonstrated zinc efflux from oocytes expressing ZnT8, validating its role as a functional transporter .

    • No significant differences in transport kinetics were observed between isoforms (long vs. short) or polymorphic variants (R325 vs. W325) .

  3. Dimerization:

    • Western blot analyses revealed ZnT8 dimers, suggesting oligomerization is essential for zinc transport activity .

Applications in Diabetes Research

ZnT8 is a therapeutic target for diabetes due to its role in insulin granule zinc loading. Recombinant Xenopus ZnT8 facilitates:

  • Mechanistic Studies: Elucidating how ZnT8 mutations (e.g., R325W) impact zinc transport and insulin secretion .

  • Autoantibody Detection: ZnT8 autoantibodies (ZnT8A) are biomarkers for type 1 diabetes; recombinant proteins aid assay development .

  • Drug Screening: High-throughput testing of ZnT8 inhibitors to modulate insulin secretion .

Available Recombinant Xenopus laevis ZnT8 Products

Commercial suppliers offer diverse recombinant ZnT8 variants for research:

ProductHostTagApplicationsSource
Partial ZnT8 (E. coli)E. coliHis-tagWB, ELISA, IPMyBioSource
Full-length ZnT8 (Mammalian)Mammalian cellsUntaggedFunctional assays, structural studiesCreative BioMart
ZnT8 with Myc/His tagsBaculovirusMyc/HisImmunofluorescence, transport assaysMyBioSource

Future Research Directions

  1. Structural Biology: Cryo-EM studies to resolve ZnT8’s 3D conformation and zinc-binding sites.

  2. In Vivo Models: Generating Xenopus laevis with tissue-specific slc30a8 knockouts to study systemic zinc metabolism.

  3. Therapeutic Targeting: Developing small molecules that modulate ZnT8 activity to treat diabetes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc30a8; Zinc transporter 8; ZnT-8; Solute carrier family 30 member 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-375
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc30a8
Target Protein Sequence
MKGPEKAYLVSDKATKMYSLTMDSSEKNNCGKPPLQDDENPHIKYHCHNNNTKAYDARQR EQTSAKKKLCIASLICFVFISAEIVGGYIAGSLAVVTDAAHLLVDLSSFFISLGSLWLSS KSSTMRLTFGWYRAEILGALMSIITIWLVTGVLVYLAIERIIRPDYTIDGTVMLITSACA LGANVVLALILHQSGHGHSHAGGKHEHMASEYKPQTNASIRAAFIHVIGDLFQSISVLIS ALIIYFKPEYKIADPICTFIFSIFVLITTVTVLRDLLNILMEGTPRGIHYSDVKQSILAV DGVKSVHSLHLWALTMNQVILSAHIATDILGESKRILKDVTQNVCSSFPFHSVTIQVEPV EEQSPECMFCYEPTQ
Uniprot No.

Target Background

Function
This protein facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, acting as a zinc-efflux transporter. It plays a role in maintaining zinc ion homeostasis and cellular distribution.
Database Links

KEGG: xla:496294

UniGene: Xl.27513

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Q&A

What is Zinc Transporter 8 and why study it in Xenopus laevis systems?

Zinc Transporter 8 (ZnT8) belongs to the Cation Diffusion Facilitator (CDF) family and functions primarily to transport zinc ions away from the cytosol. In pancreatic β-cells, ZnT8 transports zinc from the cytosol into insulin granules, where zinc facilitates insulin packaging into hexamers with two bound zinc ions and one bound calcium ion. The Xenopus laevis oocyte system offers significant advantages for studying ZnT8 function because stage VI oocytes represent a closed system for zinc exchange with minimal endogenous zinc transporter activity, allowing clear assessment of heterologously expressed transporters .

Unlike mammalian cell systems where vesicular transporters such as ZnT8 primarily localize to internal membranes, recombinant ZnT8 expressed in Xenopus oocytes localizes to the cell surface, enabling direct measurement of transport activity across the plasma membrane. This unique property makes the Xenopus system particularly valuable for zinc transport assays when compared to other experimental models such as transfected mammalian cells or artificial proteoliposomes .

What are the key structural features of human ZnT8 relevant for recombinant expression?

Human ZnT8 exists in two primary isoforms (splice variants) that differ in length due to a 49 amino acid N-terminal extension. The long isoform (N-V5-ZnT8lg) contains this extension, while the short isoform (V5-ZnT8sh) lacks it. Additionally, a single nucleotide polymorphism (SNP rs13266634) results in either arginine (R) or tryptophan (W) at position 325, with the R325 variant associated with increased risk of Type 2 Diabetes .

When designing recombinant ZnT8 constructs for Xenopus expression, researchers should consider:

  • The isoform (long vs. short)

  • The variant at position 325 (R vs. W)

  • The presence and position of epitope tags (e.g., V5)

  • Signal sequences that may affect localization

Importantly, the amino acid at position 325 is poorly conserved across species, suggesting this residue may have species-specific functions that should be considered when interpreting cross-species experiments .

How does the subcellular localization of ZnT8 isoforms differ between expression systems?

ZnT8 isoforms exhibit system-dependent localization patterns that significantly impact experimental design and interpretation:

Expression SystemLong Isoform LocalizationShort Isoform Localization
HEK293 cellsPlasma membrane and internal membranesPredominantly internal membranes
Xenopus laevis oocytesCell surface (with some internal expression)Cell surface (with some internal expression)
Pancreatic β-cells (native)Primarily insulin granules with transient plasma membrane expression during insulin secretionLess well characterized

What methodological approaches are most effective for measuring ZnT8 transport activity in Xenopus oocytes?

Radiotracer transport assays using 65Zn represent the gold standard for quantifying ZnT8-mediated zinc transport in Xenopus oocytes. Based on experimental evidence, the following methodological refinements improve assay reliability:

  • Loading method: Direct injection of 65Zn with nitrilotriacetic acid (NTA) as a chelator produces more consistent results than ionophore-mediated loading with pyrithione, which may lead to excessive compartmentalization of zinc within oocytes .

  • Optimal zinc concentration: Lower amounts of injected 65Zn (442-663 fmol) yield better results than higher amounts (995 fmol), likely because they avoid saturating transport systems .

  • Buffer composition: The presence of K+ in the efflux buffer does not significantly affect transport rates, suggesting that ZnT8-mediated transport is not directly coupled to K+ gradients .

  • pH considerations: With the intracellular and extracellular pH of Xenopus oocytes both approximately 7.4, local proton gradients potentially generated by the Na+/H+ exchanger may drive zinc efflux rather than direct pH differences across the membrane .

  • Temperature: While specific temperature optima are not described in the provided literature, maintaining consistent temperature throughout assays is critical for reproducibility.

These methodological considerations address the significant variability often observed in Xenopus oocyte assays, which can be attributed to seasonal variations in oocyte quality and differences between batches from different frogs .

How can researchers address the variability challenges in Xenopus oocyte-based ZnT8 transport assays?

Variability is a significant challenge in Xenopus oocyte-based transport assays, stemming from multiple sources:

  • Seasonal and batch-to-batch variations in oocyte quality

  • Differences in oocyte maturation stage

  • Variable expression levels of recombinant protein

  • Compartmentalization of injected 65Zn

  • Endogenous transport systems

To mitigate these challenges, researchers should implement:

  • Rigorous oocyte selection based on developmental stage (consistent use of stage VI oocytes)

  • Inclusion of multiple control groups in each experiment (non-injected, water-injected, and positive control-injected oocytes)

  • Standardization of cRNA quality and quantity through careful in vitro transcription and quantification

  • Verification of protein expression through immunofluorescence and western blotting of biotinylated cell-surface proteins

  • Assessment of protein dimerization, which appears necessary for transport activity

  • Increased biological replication to account for inherent variability

  • Statistical methods that account for nested experimental designs (oocytes from the same frog are not independent samples)

Implementing these controls can reduce inter-experimental variability and increase confidence in observed transport differences between ZnT8 variants or experimental conditions .

How do the functional properties of ZnT8 variants (R325 vs. W325) differ, and what experimental approaches best characterize these differences?

The literature contains contradictory findings regarding the functional differences between R325 and W325 variants:

Study SystemReported FindingReference
MIN6 and INS-1E rodent β-cell linesLower transport activity of R325 variant (cited in )
HEK293 cells and proteoliposomesHigher transport activity of R325 variant (cited in )
Xenopus oocytesNo detectable differences in zinc transport

These contradictory results highlight the conditional nature of ZnT8 function and the limitations of different experimental systems. To comprehensively characterize functional differences between variants, researchers should:

  • Compare variants across multiple experimental systems (cell lines, oocytes, and proteoliposomes)

  • Assess transport under various physiological conditions (different pH values, zinc concentrations, and presence of potential binding partners)

  • Evaluate both transport kinetics and zinc binding properties

  • Consider the influence of post-translational modifications and protein-protein interactions

  • Examine differences in subcellular trafficking and stability

It is particularly important to note the extremely high Km value for Zn2+ (>100 μM) measured in proteoliposomes, which is at least 250,000 times higher than resting cytosolic [Zn2+] in β-cells, raising questions about physiological relevance of some in vitro assays .

What are the critical steps in preparing recombinant ZnT8 constructs for Xenopus oocyte expression?

Successful expression of functional recombinant ZnT8 in Xenopus oocytes requires careful attention to several critical steps:

  • Vector selection: Use vectors optimized for Xenopus oocyte expression, containing appropriate 5' and 3' untranslated regions from Xenopus genes to enhance translation efficiency.

  • Codon optimization: While not explicitly mentioned in the provided literature, codon optimization for Xenopus can improve protein expression levels.

  • Epitope tagging: The V5 tag has been successfully used for ZnT8 detection in oocytes. For the long isoform (N-V5-ZnT8lg), the tag is inserted after the first 49 amino acids, while for the short isoform (V5-ZnT8sh), it is placed at the N-terminus .

  • In vitro transcription: Prepare high-quality capped cRNA using linearized plasmid templates and commercial kits designed for in vitro transcription.

  • RNA purification and quantification: Ensure RNA integrity through gel electrophoresis and accurate concentration determination.

  • Microinjection: Typically inject 50 nl of cRNA solution (0.5 μg/μl) into defolliculated stage V-VI oocytes.

  • Incubation conditions: Allow 3-4 days of expression at 18°C in modified Barth's solution before performing functional assays.

  • Expression verification: Confirm protein expression through immunofluorescence and western blotting, with particular attention to dimerization status, as ZnT8 functions as a dimer .

What controls and validation steps are essential when studying ZnT8 transport in Xenopus oocytes?

Rigorous controls and validation steps are crucial for reliable ZnT8 transport studies in Xenopus oocytes:

  • Expression controls:

    • Immunofluorescence confocal imaging to confirm plasma membrane localization

    • Cell-surface biotinylation followed by western blotting to quantify membrane expression

    • Verification of proper protein folding and dimerization through non-reducing SDS-PAGE

  • Localization controls:

    • Use of cytosolic markers (e.g., GAPDH) to confirm specificity of surface biotinylation

    • Subcellular fractionation to determine the proportion of ZnT8 in membrane versus intracellular compartments

  • Transport assay controls:

    • Non-injected oocytes to establish baseline zinc fluxes

    • Water-injected oocytes to control for injection effects

    • Oocytes expressing known zinc transporters as positive controls

    • Heat-inactivated ZnT8 to control for non-specific binding or uptake

  • Specificity controls:

    • Competition with non-radioactive zinc

    • Testing transport of other divalent cations (e.g., cadmium, nickel)

    • Use of zinc chelators in the assay media

  • Data validation:

    • Statistical analysis appropriate for nested designs (oocytes from the same frog)

    • Technical replicates within experiments

    • Biological replicates across different batches of oocytes

How can ZnT8 transport activity data from Xenopus systems be reconciled with findings from other experimental models?

Reconciling ZnT8 functional data across different experimental systems requires careful consideration of system-specific factors:

  • Differences in membrane composition and thickness between Xenopus oocytes, mammalian cells, and artificial bilayers can affect transporter conformation and activity.

  • Post-translational modifications may vary between expression systems, potentially altering transport kinetics or regulation.

  • Interacting proteins present in cellular systems but absent in proteoliposomes may modulate transport activity.

  • The ionic composition of the cytosol differs between Xenopus oocytes and mammalian cells, potentially affecting transport driving forces.

  • Transport direction varies by experimental system - in oocytes, ZnT8 mediates efflux across the plasma membrane, while in β-cells, it primarily transports zinc into insulin granules.

To integrate findings across systems, researchers should:

  • Normalize transport data to surface expression levels when comparing across systems

  • Consider the thermodynamic parameters of zinc transport rather than just net flux

  • Develop mathematical models that account for system-specific constraints

  • Validate key findings in multiple systems with complementary approaches

  • Focus on relative differences between variants rather than absolute transport rates

What is the significance of ZnT8 plasma membrane localization for β-cell function and autoimmunity?

The finding that the long isoform of ZnT8 substantially localizes to the plasma membrane has important implications for both β-cell physiology and autoimmunity in diabetes:

  • Autoantigen presentation: ZnT8 is one of four major islet autoantigens in diabetes. While previous models assumed ZnT8 only appears at the plasma membrane transiently during insulin granule fusion (glucose-induced insulin secretion, GIIS), the substantial baseline plasma membrane expression of the long isoform provides an alternative explanation for autoantigen presentation .

  • Plasma membrane zinc transport: Plasma membrane-localized ZnT8 could potentially export zinc from β-cells directly, rather than only into insulin granules, suggesting additional functions beyond insulin packaging.

  • Regulatory mechanisms: The presence of the ERTYLV sequence (amino acids 5-10) in the N-terminus of the long isoform suggests an endosome-lysosome-basolateral sorting signal that removes proteins from the plasma membrane. This sequence contains threonine and tyrosine residues, suggesting phosphorylation-dependent regulation of ZnT8 plasma membrane residence .

  • Isoform-specific functions: The differential localization of long and short isoforms suggests they may serve distinct physiological roles, potentially explaining the complex relationship between ZnT8 variants and diabetes risk.

These findings suggest that therapeutic strategies targeting ZnT8 should consider both its vesicular and plasma membrane localization, as well as isoform-specific functions .

How do the experimental conditions in Xenopus oocyte assays compare to physiological conditions in β-cells?

Understanding the differences between experimental and physiological conditions is crucial for interpreting ZnT8 transport data:

ParameterXenopus Oocyte ConditionsPancreatic β-cell ConditionsImplications
Zinc concentrationStage VI oocytes contain ~70 ng zinc; experimental loading with 442-995 fmol 65ZnFree cytosolic [Zn2+] in β-cells is ~400 pMOocyte assays may use non-physiological zinc concentrations
pHIntracellular pH ~7.4; extracellular pH typically 7.4 in assay bufferInsulin granule luminal pH is acidic (~5.5)Missing pH gradient that may be important for transport directionality
Membrane environmentOocyte plasma membraneInsulin granule membrane in β-cellsDifferent lipid composition may affect transporter function
Interacting proteinsMay lack β-cell-specific interaction partnersComplete complement of native interaction partnersPotential absence of regulatory factors in oocytes
Transport directionEfflux across plasma membraneInflux into insulin granulesOpposite transport direction from physiological function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.