Recombinant Xenopus tropicalis 2-acylglycerol O-acyltransferase 1 (mogat1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mogat1; TGas062a14.1; 2-acylglycerol O-acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; MGAT1; Monoacylglycerol O-acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
mogat1
Target Protein Sequence
MKLEFAPINIPLARRLQTTAVFQWVFSFLLLAQCCIGIFLSLVLARLWLILALYVLWLYL DWETPQAGGRRWEWVRNWTVWKYFKDYFPIRLVKTCDLDPQHNYIMGFHPHGVLVAGAFG NFCTNYTGFKELFPGLTPYLHILPFWFRCPFFREYAMCVGLVSATKKSVNHVLSKENGGN ISIIVIGGAEESLDAHPGSLILHILKRKGFIKVAFKQGAHLVPVFSFGENELFQQVPNPK GSFLRCVQERLQKIMGFAMPLFHARGIFQYSFGLMPYRMPIHTVVGRPIPVKQTSHPTQE EIESLHQQYLSALRDLFEEHKERYGIPEHESLIFT
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. It is likely not involved in dietary fat absorption in the small intestine.
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of mogat1 in Xenopus tropicalis?

Mogat1 (monoacylglycerol O-acyltransferase 1) is a lipogenic enzyme that catalyzes the conversion of monoacylglycerol to diacylglycerol in the glycerolipid synthesis pathway. In Xenopus, as in mammals, mogat1 likely plays roles in lipid metabolism and storage. While specific functions in Xenopus tropicalis are still being characterized, research in mammals suggests mogat1 is involved in processes such as adipocyte differentiation and regulation of lipolysis by re-esterifying fatty acids during periods of low lipolytic rates . The enzyme's activity may be particularly important during developmental stages when energy metabolism undergoes significant changes.

How does Xenopus tropicalis mogat1 compare structurally to mammalian orthologs?

Xenopus tropicalis mogat1 shares significant structural homology with mammalian orthologs, particularly in the conserved catalytic domains and active sites. The protein contains the characteristic acyltransferase domain found in the MOGAT family. While specific structural differences exist between species, the core enzymatic function appears conserved across vertebrates. Understanding these structural similarities and differences is essential when designing experiments to study mogat1 function or when developing recombinant expression systems.

What expression patterns does mogat1 show during Xenopus development?

Mogat1 expression patterns during Xenopus development are temporally and spatially regulated. While comprehensive expression data specifically for Xenopus tropicalis mogat1 is still emerging, research in mammals indicates that mogat1 is highly induced during adipocyte differentiation . In Xenopus, researchers typically use techniques such as in situ hybridization and RT-PCR to characterize developmental expression patterns. These analyses can provide insights into the potential developmental functions of mogat1 beyond its established role in lipid metabolism.

What expression systems are optimal for producing recombinant Xenopus tropicalis mogat1?

For producing recombinant Xenopus tropicalis mogat1, several expression systems can be considered based on research requirements:

  • E. coli expression systems: Useful for high-yield production, though proper folding of eukaryotic proteins can be challenging. BL21(DE3) strains with chaperone co-expression often improve folding of complex proteins.

  • Insect cell systems: Baculovirus expression systems provide better post-translational modifications and are often preferable for functional studies of mogat1.

  • Mammalian cell systems: HEK293 or CHO cells offer the most authentic post-translational modifications but at lower yields.

For membrane-associated proteins like mogat1, insect or mammalian cell systems typically provide better functionality due to their capacity to properly process hydrophobic domains and provide appropriate lipid environments during protein folding.

What are the critical considerations for purifying active recombinant mogat1?

Purifying enzymatically active recombinant mogat1 requires several critical considerations:

  • Detergent selection: As mogat1 is associated with membranes, selecting appropriate detergents (such as n-dodecyl β-D-maltoside or CHAPS) is crucial for maintaining protein stability and activity.

  • Buffer optimization: Buffer conditions including pH (typically 7.2-7.6), salt concentration (150-300 mM NaCl), and glycerol content (10-20%) need optimization to preserve enzymatic activity.

  • Temperature control: Purification should be performed at 4°C to minimize proteolytic degradation.

  • Affinity tags: Consider the position of affinity tags (N- or C-terminal) as they may affect enzyme activity. TEV or PreScission protease cleavage sites allow tag removal if needed for activity assays.

  • Lipid supplementation: Adding specific lipids during purification can help stabilize the protein's native conformation.

Optimization of these parameters through small-scale test purifications is recommended before scaling up production.

How can I assess the activity of purified recombinant Xenopus tropicalis mogat1?

The enzymatic activity of purified recombinant Xenopus tropicalis mogat1 can be assessed using several methodologies:

  • Radiometric assays: Using [14C]-labeled monoacylglycerol substrates to measure conversion to diacylglycerol products. This approach offers high sensitivity but requires radioisotope handling facilities.

  • LC-MS/MS analysis: Monitoring the conversion of monoacylglycerol to diacylglycerol using liquid chromatography coupled with tandem mass spectrometry, which provides detailed product characterization.

  • Spectrophotometric coupled assays: Indirect measurement of mogat1 activity by coupling the reaction to other enzymes that produce detectable products.

A typical activity assay includes:

  • Buffer (50 mM Tris-HCl, pH 7.4)

  • 100 μM monoacylglycerol substrate

  • 100 μM acyl-CoA

  • 5 mM MgCl₂

  • 1-5 μg purified enzyme

  • Incubation at 25-30°C for 10-30 minutes

Results should be validated against appropriate controls, including heat-inactivated enzyme and reaction mixtures lacking specific substrates.

What CRISPR-Cas9 strategies are effective for mogat1 knockout in Xenopus tropicalis?

Effective CRISPR-Cas9 strategies for mogat1 knockout in Xenopus tropicalis include:

  • Target site selection: Design guide RNAs targeting the 5' portion of the coding region, particularly within early exons, to ensure frameshift mutations lead to complete loss of function . Multiple gRNAs can be used simultaneously to increase knockout efficiency.

  • Delivery method: Microinjection of Cas9 protein pre-complexed with synthesized guide RNAs (ribonucleoprotein complexes) into fertilized eggs at the one-cell stage provides efficient genome editing.

  • Validation strategy: Confirm successful editing through a combination of:

    • Sanger sequencing of PCR amplicons from F0 mosaic individuals

    • T7 endonuclease I assay to detect heteroduplexes forming from wildtype and mutant DNA

    • Breeding F0 individuals with wildtypes to establish stable germline-transmitted F1 lines

  • Genotyping protocol: Extract DNA from tadpole tail clips or adult toe clips using standard extraction kits, followed by PCR amplification and sequencing to identify frameshift mutations.

This approach has been successfully employed for generating knockout lines in Xenopus for various genes including sex-related genes .

How can I establish stable mogat1 transgenic Xenopus tropicalis lines?

Establishing stable mogat1 transgenic Xenopus tropicalis lines involves several key steps:

  • Construct design:

    • For overexpression: Create a construct containing the mogat1 coding sequence under a tissue-specific or ubiquitous promoter (e.g., CMV, CAG)

    • For tagged versions: Include epitope tags (e.g., FLAG, HA) for detection and purification

    • Include flanking Tol2 or I-SceI meganuclease sites to enhance genomic integration

  • Delivery to embryos:

    • Microinject constructs (10-50 pg) with transposase mRNA or meganuclease into fertilized eggs at the one-cell stage

    • Ensure uniform distribution by injecting into the animal pole

  • Selection of founders:

    • Screen F0 mosaic individuals for transgene integration using PCR or fluorescent reporter expression

    • Cross positive F0 individuals with wildtypes to generate F1 offspring

    • Screen F1 offspring to identify those with germline transmission

  • Line maintenance:

    • Intercross F1 heterozygous carriers to establish homozygous lines

    • Maintain stocks through regular breeding and genotyping

    • Keep detailed records of lineage and phenotypic characteristics

Transgenic lines typically require 6-12 months to establish from initial injection to homozygous line characterization.

What are effective approaches for temporal and tissue-specific mogat1 expression control?

Effective approaches for temporal and tissue-specific mogat1 expression control in Xenopus include:

  • Inducible expression systems:

    • Tetracycline-inducible (Tet-On/Tet-Off) system allows temporal control through doxycycline administration

    • Heat shock-inducible promoters provide tight temporal control through temperature shifts

    • Hormone-responsive elements (e.g., progesterone or estrogen response elements) offer another induction method

  • Tissue-specific promoters:

    • Liver-specific: albumin or transthyretin promoters

    • Muscle-specific: muscle creatine kinase or myosin light chain promoters

    • Neural tissue: neural β-tubulin or Sox2 promoters

    • Adipose tissue: FABP4 or adiponectin promoters (particularly relevant for mogat1 studies)

  • Cre-loxP system:

    • Generate lines with floxed mogat1 alleles

    • Cross with lines expressing Cre recombinase under tissue-specific promoters

    • For temporal control, use tamoxifen-inducible CreERT2 systems

  • Targeted mRNA injection:

    • For embryonic studies, inject mogat1 mRNA into specific blastomeres to target particular tissues

    • Co-inject with lineage tracers (e.g., fluorescent dextrans) to confirm targeting

These approaches allow researchers to dissect the function of mogat1 in specific tissues and developmental stages, which is particularly useful given the potential diverse roles of this enzyme.

How does mogat1 knockout affect lipid metabolism in Xenopus tropicalis?

Mogat1 knockout effects on lipid metabolism in Xenopus tropicalis likely parallel findings in mammalian systems, though with species-specific differences. Based on mammalian studies, predicted effects include:

  • Altered glycerolipid synthesis: Disruption of the monoacylglycerol pathway for triglyceride synthesis, potentially leading to compensatory upregulation of alternative pathways (glycerol-3-phosphate pathway).

  • Modified lipid storage patterns: Potential reduction in lipid droplet formation and size in adipose tissue and liver.

  • Changed lipid profiles: Altered ratios of diacylglycerols to triacylglycerols, with potential accumulation of monoacylglycerols.

Assessment methodologies should include:

  • Lipidomic analysis using LC-MS/MS to quantify various lipid species

  • Oil Red O staining of tissues to visualize neutral lipid distribution

  • Transmission electron microscopy to examine lipid droplet morphology

  • Gene expression analysis of compensatory lipid synthesis enzymes

In mammalian studies, mogat1 knockout showed variable phenotypes depending on genetic background and environmental conditions , suggesting careful control of experimental variables is essential in Xenopus studies.

What role does mogat1 play in Xenopus tropicalis development and differentiation?

Based on mammalian studies, mogat1 likely plays important roles in Xenopus tropicalis development and differentiation, particularly in tissues with high lipid metabolism:

  • Adipose tissue development: In mammals, mogat1 is highly induced during adipocyte differentiation, and its knockout reduces differentiation capacity and glycerolipid accumulation in preadipocytes . In Xenopus, similar roles may exist during the development of fat bodies or other lipid-storing tissues.

  • Early embryonic development: As a participant in lipid metabolism, mogat1 may influence energy utilization from yolk reserves during early embryogenesis.

  • Metamorphosis: The dramatic remodeling during amphibian metamorphosis involves significant changes in energy metabolism, where mogat1 could play a role in tissue reorganization and energy resource allocation.

  • Organ development: Potential roles in liver and intestinal development, where lipid processing is critical.

Research approaches to investigate these roles include:

  • Temporal expression analysis across developmental stages

  • Tissue-specific expression profiling

  • Loss-of-function studies coupled with detailed phenotypic analysis

  • Rescue experiments with wild-type or mutant mogat1 constructs

While specific data on mogat1's developmental roles in Xenopus is still emerging, the conservation of metabolic pathways suggests parallels to mammalian systems.

How can I analyze mogat1 expression patterns in different tissues and developmental stages?

Analysis of mogat1 expression patterns in Xenopus tropicalis requires a multi-faceted approach:

  • Quantitative RT-PCR (qRT-PCR):

    • Sample collection from various tissues and developmental stages

    • RNA extraction using TRIzol or RNeasy kits

    • cDNA synthesis and qPCR with mogat1-specific primers

    • Normalization against stable reference genes (e.g., ODC1, rpl8)

  • Whole-mount in situ hybridization (WISH):

    • Design antisense RNA probes against mogat1 mRNA

    • Process embryos using standard WISH protocols

    • Image and analyze spatial expression patterns

    • Consider double WISH with markers of specific tissues

  • Immunohistochemistry:

    • Develop or obtain antibodies against Xenopus tropicalis mogat1

    • Validate antibody specificity using knockout controls

    • Process tissue sections or whole-mounts for immunostaining

    • Counterstain with markers for specific cell types

  • Single-cell RNA sequencing:

    • Dissociate tissues into single cells

    • Perform scRNA-seq to identify cell populations expressing mogat1

    • Integrate with existing Xenopus single-cell atlases

    • Analyze co-expression patterns with other metabolic genes

  • Reporter transgenic lines:

    • Generate transgenic lines with fluorescent reporters under mogat1 promoter control

    • Image living embryos and tissues across development

    • Perform time-lapse imaging to track dynamic expression changes

These complementary approaches provide comprehensive spatial and temporal information about mogat1 expression, essential for understanding its functional roles.

How can I investigate mogat1 protein interactions and complex formation?

Investigating mogat1 protein interactions and complex formation requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of mogat1 (FLAG, HA, or Myc) in Xenopus oocytes or cell lines

    • Perform IP using tag-specific antibodies

    • Identify interacting partners through mass spectrometry analysis

    • Validate specific interactions with Western blotting

  • Proximity labeling techniques:

    • Generate BioID or TurboID fusions with mogat1

    • Express in relevant tissues or cell types

    • Perform biotin labeling followed by streptavidin pulldown

    • Identify proximal proteins through mass spectrometry

  • Yeast two-hybrid screening:

    • Use mogat1 as bait against Xenopus cDNA libraries

    • Screen for positive interactions

    • Confirm interactions using alternative methods

  • FRET or BiFC analysis:

    • Create fluorescent protein fusions (e.g., CFP-mogat1 and YFP-candidate)

    • Express in cells or embryos

    • Measure energy transfer or complementation signals

    • Analyze subcellular localization of interaction

  • Crosslinking mass spectrometry:

    • Apply chemical crosslinkers to preserve transient interactions

    • Purify mogat1-containing complexes

    • Identify crosslinked peptides through specialized MS/MS analysis

    • Generate structural models of protein complexes

These approaches can reveal mogat1's integration within metabolic enzyme complexes and potentially identify novel regulatory interactions specific to Xenopus.

What approaches help resolve contradictory data regarding mogat1 function?

Resolving contradictory data regarding mogat1 function requires systematic investigation:

  • Genetic background analysis:

    • Compare results across different strains/populations of Xenopus tropicalis

    • Generate knockouts on multiple genetic backgrounds

    • Test for modifier genes that influence phenotypic outcomes

  • Environmental and experimental condition standardization:

    • Carefully control temperature, feeding, housing conditions

    • Standardize experimental protocols across laboratories

    • Document all experimental variables systematically

  • Dosage and compensation evaluation:

    • Generate allelic series (hypomorphs to nulls)

    • Investigate potential genetic compensation mechanisms

    • Perform acute vs. chronic loss-of-function studies

    • Create double knockouts with related enzymes (e.g., dgat1, dgat2)

  • Tissue-specific analysis:

    • Use conditional knockouts to isolate tissue-specific effects

    • Perform tissue-specific rescue experiments

    • Analyze cell-autonomous vs. non-cell-autonomous effects

  • Developmental timing consideration:

    • Use inducible systems for temporal control of gene disruption

    • Analyze phenotypes across multiple developmental stages

    • Consider maternal contribution in early developmental studies

Research in mammals has shown variable phenotypes for mogat1 knockout, with differences between in vitro and in vivo findings , highlighting the importance of comprehensive experimental design and careful interpretation.

How can I integrate mogat1 research with broader metabolic pathway studies?

Integrating mogat1 research with broader metabolic pathway studies in Xenopus tropicalis involves:

  • Multi-omics approaches:

    • Combine transcriptomics, proteomics, and lipidomics analyses

    • Perform metabolic flux analysis using stable isotope labeling

    • Create network models integrating multiple data types

  • Pathway manipulation experiments:

    • Pharmacological inhibition of related pathways

    • Dietary interventions (high-fat vs. standard feeding)

    • Combined genetic manipulation of multiple pathway components

    • Metabolic challenge tests (fasting/refeeding, cold exposure)

  • Comparative studies across species:

    • Compare Xenopus tropicalis findings with X. laevis (tetraploid)

    • Extend comparisons to mammalian and non-mammalian vertebrates

    • Analyze evolution of metabolic pathways across species

  • Integration with signaling pathways:

    • Investigate crosstalk between lipid metabolism and developmental signaling

    • Examine regulation by hormones and growth factors

    • Study interaction with stress response pathways

  • Systems biology approaches:

    • Develop computational models of glycerolipid metabolism

    • Perform in silico simulations of pathway perturbations

    • Generate testable hypotheses for experimental validation

This integrated approach places mogat1 research within the broader context of metabolic regulation and developmental biology, providing insights into how specific enzymatic functions contribute to organismal physiology.

How can I address common challenges in recombinant Xenopus tropicalis mogat1 expression?

Addressing common challenges in recombinant Xenopus tropicalis mogat1 expression:

  • Low expression levels:

    • Optimize codon usage for expression system

    • Test different promoters (T7, CMV, CAG)

    • Reduce culture temperature (16-20°C) to improve folding

    • Co-express chaperones (GroEL/ES, DnaK/J)

    • Try fusion partners (SUMO, MBP, TrxA) to enhance solubility

  • Protein insolubility:

    • Modify extraction buffers with various detergents (CHAPS, DDM, Triton X-100)

    • Test different solubilization strategies (urea, guanidine HCl followed by refolding)

    • Consider membrane fraction preparation instead of soluble fraction

    • Evaluate different cell lysis methods (sonication vs. French press vs. detergent)

  • Protein instability:

    • Add protease inhibitors during all purification steps

    • Include stabilizing agents (glycerol 10-20%, specific lipids)

    • Maintain strict temperature control during purification (4°C)

    • Consider adding reducing agents (DTT, β-mercaptoethanol)

  • Loss of enzymatic activity:

    • Test activity immediately after cell lysis

    • Try various buffer conditions for activity preservation

    • Consider immobilization on appropriate resins

    • Store enzyme with substrate analogs or in glycerol at -80°C

  • Aggregation during storage:

    • Filter through 0.22 μm before storage

    • Test various storage buffers and additives

    • Aliquot and flash-freeze to avoid freeze-thaw cycles

    • Consider lyophilization with appropriate excipients

Systematic optimization through small-scale expression and purification trials can help identify optimal conditions for your specific research needs.

What strategies help overcome difficulties in phenotyping mogat1 knockout Xenopus?

Strategies to overcome difficulties in phenotyping mogat1 knockout Xenopus:

  • Embryonic lethality challenges:

    • Use conditional knockout approaches

    • Perform careful staging and timing of phenotypic analysis

    • Consider maternal-zygotic contribution with appropriate breeding schemes

    • Use tissue-specific knockout to bypass systemic effects

  • Subtle phenotype detection:

    • Employ quantitative measurements rather than qualitative assessment

    • Increase sample sizes for statistical power

    • Develop standardized assay conditions

    • Use automated imaging and analysis software

    • Challenge animals with metabolic stress (high-fat diet, fasting)

  • Variability between individuals:

    • Control for genetic background through backcrossing

    • Standardize husbandry conditions (temperature, feeding, density)

    • Use sibling controls whenever possible

    • Consider clutch effects in statistical analysis

  • Complex tissue phenotypes:

    • Use advanced imaging techniques (confocal, light sheet microscopy)

    • Develop tissue-clearing protocols for whole-organ analysis

    • Employ tissue-specific reporters to highlight structures of interest

    • Consider non-invasive imaging for longitudinal studies

  • Compensatory mechanism detection:

    • Perform transcriptomic analysis to identify upregulated genes

    • Create combined knockouts of functionally related genes

    • Use acute inhibition (morpholinos, CRISPRi) alongside genetic knockout

    • Analyze early timepoints before compensation occurs

These approaches can help reveal phenotypes that might otherwise be masked by developmental plasticity or genetic redundancy.

How can I validate antibodies and probes for Xenopus tropicalis mogat1 detection?

Comprehensive validation of antibodies and probes for Xenopus tropicalis mogat1 detection:

  • Antibody validation strategies:

    • Genetic validation: Test antibodies on tissues from mogat1 knockout animals

    • Overexpression validation: Test on tissues overexpressing tagged mogat1

    • Cross-reactivity assessment: Test on tissues expressing related proteins (mogat2, dgat1)

    • Peptide competition: Pre-incubate antibody with immunizing peptide

    • Multiple antibody approach: Compare results from antibodies recognizing different epitopes

  • RNA probe validation:

    • Sequence verification of probe templates

    • Use sense probes as negative controls

    • Compare with qRT-PCR data across tissues

    • Test on mogat1 knockout samples

    • Perform parallel detection with two non-overlapping probes

  • Validation across techniques:

    • Compare results across multiple detection methods (Western blot, IHC, IF)

    • Correlate protein detection with mRNA expression data

    • Validate subcellular localization against known distribution patterns

    • Confirm specificity in heterologous expression systems

  • Cross-species validation:

    • Test reactivity with recombinant proteins from related species

    • Compare staining patterns across Xenopus species

    • Evaluate conservation of recognized epitopes through sequence alignment

  • Documentation standards:

    • Record complete validation data including all controls

    • Document antibody source, catalog number, lot, dilution

    • Note fixation conditions, antigen retrieval methods

    • Share validation data with published results

Thorough validation ensures reliable detection and prevents misinterpretation of results, particularly important for studying proteins like mogat1 that may have related family members with similar sequences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.