Recombinant Xenopus tropicalis 2-acylglycerol O-acyltransferase 2 (mogat2)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Xenopus tropicalis 2-acylglycerol O-acyltransferase 2 (mogat2) is an enzyme that catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA . It is found in the tropical clawed frog (Xenopus tropicalis) . Diacylglycerol is a precursor of triacylglycerol . The mogat2 gene encodes a protein that exhibits 2-acylglycerol O-acyltransferase activity .

Protein Information

Protein Information
Protein Name2-acylglycerol O-acyltransferase 2
Accession CodeQ5M8H5
Genemogat2
OrganismXenopus tropicalis, Tropical clawed frog (Taxonomy: 8364)
Part of Reference Proteome?Yes
Sequence (Length: 335)

Function and Characteristics

  • Catalytic Activity Xenopus tropicalis 2-acylglycerol O-acyltransferase 2 (Mogat2) catalyzes the formation of diacylglycerol by transferring an acyl chain from fatty acyl-CoA to a monoacylglycerol .

  • Location The enzyme is located in the perinuclear region, the cytoplasmic region just around the nucleus .

  • Membrane Topology Mogat2 has a transmembrane topology, as determined by sequence analysis .

  • Involvement in Disease In rat models, Mogat2 is associated with hepatocellular carcinoma .

  • Homology Mogat2 has an ortholog that exhibits acetyltransferase activity .

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mogat2; 2-acylglycerol O-acyltransferase 2; Acyl-CoA:monoacylglycerol acyltransferase 2; MGAT2; Monoacylglycerol O-acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
mogat2
Target Protein Sequence
MWIHFAPLKIPFSRRLQTGAVLQWAVSFLAMAQCCIALYILLLFSRYWYLAVLYGVWLYI DWDTPSKGGRRSNWVRSWTVWKYFAEYFPIKLLCTAPLDPKYNYIMGFHPHGVLVVGAFG NFCTEGTGFSRLFPGLTPHLLMLPAWFRVPFFREYIMSGSLVSSDRSSAHHLLSQKSGGQ ALVIAVGGPPEALDAKPGELTLQLLNRTGFIKMALTHGAHLVPVLSFGENDLYNQVNNPR GSLLRATQEKLQKIFGIALPLFHGRGVFQYSWGLLPHRRPIYTVVGSPIHVTKTPCPTRE QISSLHSLYIAKLRDLFETHKGNYGIPEDRSLVLC
Uniprot No.

Target Background

Function
Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA.
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

What is Xenopus tropicalis 2-acylglycerol O-acyltransferase 2 (mogat2)?

Xenopus tropicalis 2-acylglycerol O-acyltransferase 2 (mogat2) is a protein-coding gene found in the tropical clawed frog with Entrez Gene ID 496754. It is also known by synonyms dgat2l5 and mogat2, and functions as a monoacylglycerol O-acyltransferase . This enzyme catalyzes the synthesis of diacylglycerol from monoacylglycerol and acyl-CoA, playing a crucial role in lipid metabolism pathways. The full gene name is monoacylglycerol O-acyltransferase 2, gene 1 (mogat2.1) in the Xenopus tropicalis genome annotation.

Gene information is summarized in the following table:

ParameterInformation
Gene Symbolmogat2.1
Entrez Gene ID496754
Full Namemonoacylglycerol O-acyltransferase 2, gene 1
Synonymsdgat2l5, mogat2
Gene Typeprotein-coding
OrganismXenopus tropicalis (tropical clawed frog)

Why is Xenopus tropicalis used as a model for mogat2 research?

Xenopus tropicalis offers several advantages as a model organism for studying genes like mogat2:

The diploid genome of Xenopus tropicalis, unlike the pseudotetraploid Xenopus laevis, simplifies genetic analysis and makes it easier to observe loss-of-function phenotypes . This is particularly valuable when studying metabolic enzymes like mogat2 where gene redundancy can mask phenotypes. Unlike zebrafish, which experienced whole genome duplication, X. tropicalis maintained a diploid state, reducing complications from redundant gene functions .

Additionally, Xenopus provides versatile experimental options, offering both in vitro systems (oocyte/egg extracts) and in vivo models that can be easily manipulated . This versatility allows researchers to study mogat2 function in various contexts, from biochemical assays to developmental biology.

What developmental roles does mogat2 play in Xenopus tropicalis?

While the specific developmental roles of mogat2 in Xenopus tropicalis have not been extensively documented in the provided search results, a methodological approach to investigating this would include:

  • Temporal expression analysis: Using RNA-seq or qPCR to track mogat2 expression across developmental stages (gastrulation, neurulation, organogenesis, metamorphosis) .

  • Spatial expression mapping: Employing in situ hybridization to determine tissue-specific expression patterns, particularly focusing on tissues involved in lipid metabolism such as developing liver, intestine, and adipose tissues.

  • Loss-of-function studies: Utilizing antisense morpholino oligonucleotides (MOs) or CRISPR-Cas9 genome editing to observe phenotypic consequences of mogat2 disruption .

Based on its enzymatic function, mogat2 likely contributes to lipid metabolism during development, potentially playing important roles during stages requiring significant energy resources, such as metamorphosis when the organism undergoes dramatic physiological changes.

How can I effectively design CRISPR-Cas9 experiments to study mogat2 in Xenopus tropicalis?

To successfully employ CRISPR-Cas9 for mogat2 functional studies in Xenopus tropicalis:

  • Design sgRNAs targeting mogat2's coding region, preferably early exons to ensure complete loss of function. The sgRNA should complement sequence between -80 and +25 bases of the initiating AUG codon for optimal results .

  • Validation protocol:

    • Design different non-overlapping MOs directed against the same mRNA

    • Test MOs differing in five bases to confirm specificity

    • Perform "rescue" experiments with wild-type mogat2 mRNA

  • Delivery method: Inject a mixture of the selected sgRNA and Cas9 recombinant protein into early embryos (1-cell stage) .

  • Analysis approach: The inDelphi algorithm can accurately predict CRISPR/Cas9-induced repair outcomes in X. tropicalis with high correlation between predicted and experimentally observed frequencies (Pearson r = 0.9886, p < 0.0001) .

  • Genotyping: Analyze editing efficiency using amplicon deep sequencing of the targeted mogat2 region to identify specific deletion or insertion patterns .

This approach has been successfully used to generate genetically modified Xenopus tropicalis lines for cancer and developmental studies, making it suitable for mogat2 functional analysis .

What expression systems are optimal for producing functional recombinant Xenopus tropicalis mogat2?

Several expression systems can be employed for recombinant mogat2 production, each with distinct advantages:

  • Xenopus oocyte/egg extract system:

    • Advantages: Native cellular environment, appropriate post-translational modifications, suitable for functional studies

    • Protocol: Microinject mogat2 mRNA into oocytes, incubate for 24-48 hours, then extract protein

    • Applications: Ideal for studying mogat2 in its native context, particularly for functional assays

  • Insect cell expression:

    • Advantages: Higher protein yield, eukaryotic post-translational modifications

    • Protocol: Clone mogat2 cDNA into baculovirus transfer vectors, transfect insect cells, harvest after 48-72 hours

    • Applications: Bulk protein production for biochemical characterization and structural studies

  • Mammalian cell expression:

    • Advantages: Most complex post-translational modifications, membrane protein handling

    • Protocol: Transfect HEK293 or CHO cells with vectors containing mogat2 cDNA

    • Applications: Studies requiring interaction with mammalian proteins or lipid environments

Based on mogat2's nature as a lipid-metabolizing enzyme, systems capable of properly handling membrane-associated proteins will likely yield the most functional product.

How can I optimize the purification of recombinant Xenopus tropicalis mogat2?

Purification of functional mogat2 requires carefully optimized protocols considering its biochemical properties:

  • Solubilization strategy:

    • Use mild detergents (CHAPS, DDM, or Triton X-100) to extract membrane-associated mogat2

    • Include lipid additives (phosphatidylcholine or cardiolipin) to maintain native conformation

    • Optimize detergent concentration to prevent protein aggregation or denaturation

  • Multi-step purification approach:

    • Initial capture: Affinity chromatography using His-tag or GST-fusion constructs

    • Intermediate purification: Ion exchange chromatography based on theoretical pI

    • Final polishing: Size exclusion chromatography to remove aggregates and contaminants

  • Activity preservation:

    • Maintain reducing conditions with DTT or β-mercaptoethanol

    • Include glycerol (10-20%) in storage buffers

    • Add appropriate lipid substrates to stabilize active site

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Enzyme activity assays measuring conversion of monoacylglycerol to diacylglycerol

    • Thermal shift assays to optimize buffer conditions for stability

This methodological approach provides a framework for obtaining pure, active recombinant mogat2 suitable for downstream applications.

How can I establish a mogat2 knockout Xenopus tropicalis line for cancer metabolism studies?

Creating a stable mogat2 knockout line for cancer metabolism studies requires a systematic approach:

  • CRISPR-Cas9 editing strategy:

    • Design sgRNAs targeting the mogat2 coding region as described earlier

    • Inject Cas9 protein/sgRNA complex into fertilized eggs at the one-cell stage

    • Raise F0 animals to adulthood and genotype using fin clip DNA

  • Germline transmission screening:

    • Outcross mosaic F0 frogs with wild-type animals

    • Screen F1 offspring for heterozygous carriers using PCR and sequencing

    • Intercross heterozygous F1 animals to generate homozygous knockouts in F2

  • Phenotypic characterization:

    • Document developmental timing, morphological abnormalities, and viability

    • Analyze lipid metabolism through biochemical assays and lipidomic profiling

    • Assess cancer susceptibility using tumor transplantation models

  • Tumor transplantation studies:

    • Generate primary tumors through additional genetic modifications (e.g., tp53 knockout)

    • Transplant tumor cells intraperitoneally into mogat2-/- animals

    • Monitor tumor growth, invasiveness, and metabolic parameters

The established rag2-/- line in X. tropicalis provides an immunocompromised background that could be crossed with mogat2 mutants to enable tumor transplantation studies without immune rejection .

How does mogat2 expression change during different developmental stages in Xenopus tropicalis?

To methodically analyze mogat2 expression across developmental stages:

  • Temporal expression analysis:

    • Collect tissue samples from standardized developmental stages (e.g., NF stages 10, 25, 41, 50, 56, and juvenile)

    • Extract RNA and perform RT-qPCR or RNA-seq

    • Apply appropriate normalization and statistical analysis (q-value ≤ 0.01; fold change ≥ 1.5)

  • Data visualization and interpretation:

    • Generate volcano plots to visualize significance and magnitude of expression changes between stages

    • Create heatmaps for hierarchical clustering of expression patterns

    • Perform principal component analysis to identify major trends

  • Correlation with developmental events:

    • Analyze expression in context of major developmental transitions (gastrulation, neurulation, organogenesis, metamorphosis)

    • Link expression changes with the formation of tissues requiring lipid metabolism

Based on the search results' methodologies, this approach would provide detailed insights into mogat2's role throughout development, particularly during the transition from larval to juvenile stages when significant metabolic remodeling occurs .

What are the challenges in studying mogat2 function using morpholino knockdown approaches?

Morpholino knockdown studies of mogat2 in Xenopus tropicalis present several methodological challenges:

  • Specificity concerns:

    • Design challenge: MOs must complement sequence between -80 and +25 bases of the initiating AUG codon

    • Validation requirements: Need for multiple non-overlapping MOs and rescue experiments to confirm specificity

    • Off-target effects: Can generate misleading phenotypes unrelated to mogat2 function

  • Technical considerations:

    • Dosage optimization: Insufficient concentration causes incomplete knockdown while excess causes toxicity

    • Temporal limitations: MO efficacy decreases over time, limiting studies to early developmental stages

    • Uneven distribution: Injected MOs may distribute unevenly across blastomeres

  • Data interpretation challenges:

    • Partial knockdown effects: Unlike complete knockout, residual protein may mask phenotypes

    • Maternal contribution: Pre-existing maternal mRNA and protein may compensate for zygotic knockdown

    • Functional redundancy: Other acyltransferases might compensate for mogat2 reduction

To address these challenges, researchers should implement thorough controls including:

  • Use of 5-base mismatched control MOs

  • Phenotypic rescue with mogat2 mRNA co-injection

  • Western blot confirmation of protein knockdown

  • Parallel CRISPR-Cas9 approaches for validation

How do I analyze transcriptomic data to identify mogat2-related gene networks in Xenopus tropicalis?

To identify mogat2-associated gene networks from transcriptomic data:

  • Differential expression analysis workflow:

    • Preprocess raw data using appropriate methods (e.g., GCRMA for microarrays or DESeq2/edgeR for RNA-seq)

    • Assess data quality through boxplots, scatter plots, and hierarchical clustering

    • Identify differentially expressed genes using statistical thresholds (q-value ≤ 0.01; fold change ≥ 1.5)

  • Network analysis approaches:

    • Co-expression analysis: Identify genes with expression patterns correlated with mogat2

    • Pathway enrichment: Use tools like KEGG, GO, or Reactome to identify enriched pathways

    • Protein-protein interaction networks: Integrate with databases like STRING or BioGRID

  • Synphenotype grouping methodology:

    • Group genes based on similar loss-of-function phenotypes when knocked down/out

    • Compare with synexpression groups (genes with similar expression patterns)

    • Identify discrepancies between synphenotype and synexpression groups to uncover novel functional relationships

How can I reconcile conflicting data about mogat2 function from different experimental approaches?

When faced with contradictory results regarding mogat2 function:

  • Systematic comparison methodology:

    • Create a comprehensive table documenting experimental conditions, genetic backgrounds, developmental stages, and outcomes across studies

    • Identify consistent findings versus conflicting results

    • Evaluate methodological differences that might explain discrepancies

  • Technical validation approach:

    • Replicate key experiments using standardized protocols

    • Apply multiple complementary techniques to assess the same parameter

    • Consider genetic background effects by using different X. tropicalis strains

  • Biological explanation framework:

    • Investigate context-dependent functions of mogat2 in different tissues or developmental stages

    • Consider compensatory mechanisms that might mask phenotypes in certain conditions

    • Explore potential interactions with other metabolic enzymes

  • Integrative analysis:

    • Perform meta-analysis of available data using statistical methods that account for inter-study variability

    • Develop mechanistic models that might reconcile apparently contradictory findings

    • Use gynogenetic screening approaches to rapidly identify genetic modifiers that might explain variable phenotypes

This methodological approach provides a framework for resolving conflicts in the literature and developing a more nuanced understanding of mogat2 function.

What bioinformatic tools are most effective for comparative analysis of mogat2 across species?

For robust comparative analysis of mogat2 across species:

  • Sequence analysis toolkit:

    • Multiple sequence alignment: MUSCLE or Clustal Omega for accurate protein alignment

    • Phylogenetic analysis: Maximum likelihood methods using RAxML or IQ-TREE

    • Domain identification: InterProScan or SMART for functional domain annotation

  • Structural analysis workflow:

    • Homology modeling: SWISS-MODEL or AlphaFold2 for protein structure prediction

    • Structural alignment: TM-align or DALI for comparison with related enzymes

    • Active site analysis: ConSurf for evolutionary conservation of functional residues

  • Synteny analysis approach:

    • Genome context comparison using Genomicus or SynFind

    • Identification of conserved neighboring genes across species

    • Analysis of potential regulatory elements using PhyloP or GERP scores

  • Expression pattern comparison:

    • Cross-species transcriptome analysis to identify conservation of expression

    • Enrichment analysis to determine tissue specificity patterns across species

    • Correlation of expression with metabolic requirements in different organisms

  • Data integration strategy:

    • Utilize OrthoDB or OrthoFinder to establish reliable orthology relationships

    • Integrate functional genomics data from different species

    • Apply systems biology approaches to compare mogat2's role in metabolic networks

This comprehensive approach allows researchers to understand both the evolutionary conservation and species-specific adaptations of mogat2 across vertebrate lineages.

What emerging technologies could advance the study of mogat2 function in Xenopus tropicalis?

Several cutting-edge technologies hold promise for mogat2 research:

  • Advanced genome editing approaches:

    • Base editing systems for precise nucleotide changes without double-strand breaks

    • Prime editing for targeted insertions and complex edits in mogat2

    • Conditional knockout strategies using Cre-loxP or similar systems adapted for Xenopus

  • Single-cell technologies:

    • scRNA-seq to map mogat2 expression at cellular resolution across tissues

    • Spatial transcriptomics to correlate mogat2 expression with anatomical features

    • CRISPR lineage tracing to study cell fate decisions influenced by mogat2

  • Advanced imaging methods:

    • Live imaging of fluorescently tagged mogat2 in transparent Xenopus embryos

    • Super-resolution microscopy for subcellular localization studies

    • Label-free imaging techniques for tracking lipid metabolism in vivo

  • Transplantation innovations:

    • Refinement of tumor allotransplantation models in rag2-/- X. tropicalis

    • Development of organ-specific transplantation techniques

    • Humanized Xenopus models expressing human versions of mogat2 and interacting proteins

The continued development of these technologies will provide unprecedented insights into mogat2 function in normal development and disease contexts.

How might mogat2 research in Xenopus tropicalis contribute to understanding human metabolic disorders?

Xenopus tropicalis mogat2 research has significant translational potential:

  • Comparative functional analysis:

    • Systematic comparison of enzymatic properties between Xenopus and human mogat2

    • Identification of conserved regulatory mechanisms controlling expression and activity

    • Structural studies to understand substrate specificity differences

  • Disease modeling approach:

    • Generate Xenopus models mimicking human MOGAT2 mutations

    • Characterize phenotypic consequences on lipid metabolism and energy homeostasis

    • Test potential therapeutic compounds in these models

  • Developmental context insights:

    • Understand how mogat2 functions change during developmental transitions

    • Identify critical windows where mogat2 dysfunction has maximal impact

    • Correlate with human developmental disorders associated with lipid metabolism

  • Cancer metabolism applications:

    • Explore mogat2's role in tumor metabolism using Xenopus cancer models

    • Test mogat2 inhibitors as potential anti-cancer therapeutics

    • Develop combination approaches targeting multiple metabolic enzymes

The versatility of Xenopus as both an in vitro and in vivo model system makes it particularly valuable for translational research bridging basic science and clinical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.