Recombinant Xenopus tropicalis Adenosine monophosphate-protein transferase FICD (ficd)

Shipped with Ice Packs
In Stock

Description

Introduction

Xenopus tropicalis Adenosine monophosphate-protein transferase FICD (ficd) is an enzyme involved in post-translational modification, specifically AMPylation and deAMPylation. FICD proteins, characterized by a core HPFxxGNGR motif, are evolutionarily conserved from bacteria to humans . In animals, FICD is a type II transmembrane protein found in the endoplasmic reticulum (ER) . Xenopus tropicalis, a frog species, serves as a significant vertebrate model in biological research .

Biochemical Function

FICD catalyzes two opposing reactions: AMPylation and deAMPylation . AMPylation involves the addition of an adenosine monophosphate (AMP) moiety to a target protein, while deAMPylation removes it. Animal FICD, located in the ER lumen, performs these reactions on the BiP protein (also known as GRP78 or HSPA5) .

  • AMPylation of BiP: FICD-mediated AMPylation occurs on a single residue, Thr518, of BiP . This modification locks BiP in a conformation that reduces its affinity for substrates and impairs its response to J-domain co-factors, effectively neutralizing its chaperone activity .

  • Regulation of BiP Activity: By controlling the AMPylation status of BiP, FICD regulates BiP's function as a key regulator of ER stress response .

Xenopus tropicalis as a Model Organism

Xenopus tropicalis is increasingly utilized in genetic and developmental studies due to its simpler genome and shorter generation time compared to Xenopus laevis . The Xenopus system has been instrumental in the discovery of cell cycle regulators, such as cyclins and cyclin-dependent kinases (CDKs) . The high-quality draft genome sequence of Xenopus tropicalis facilitates the connection between genetic changes and developmental milestones in related species .

Role in Disease

FICD plays a role in diseases linked to cell cycle dysregulation, such as cancer . FICD is also relevant in the context of neglected tropical diseases, with studies identifying compounds that inhibit Trypanosoma brucei, the parasite causing human African trypanosomiasis .

Research Findings

  • Regulation of BiP AMPylation: Research indicates that FICD is essential for BiP AMPylation . Studies using mutant cell lines have demonstrated that the absence of FICD activity results in a background signal in immunoblot, confirming FICD's role in BiP AMPylation .

  • Response to ER Stress: The imposition of ER stress markedly lowered the BiP-AMP signal in wild-type cells . In FICDR371S mutant cells, ER stress had a weaker effect on BiP-AMP levels, suggesting that the mutation affects the regulation of BiP AMPylation under ER stress conditions .

  • Genome Sequencing: The first draft genome sequence of Xenopus tropicalis has been reported, setting the stage for a more complete genetic analysis of this popular frog . The availability of the Xenopus genome opens up the possibility of studying the effect of endocrine disruptors at the molecular and genomic level .

Experimental Techniques

  • CRISPR/Cas9-mediated homologous recombination: This technique is used to replace the endogenous wild-type FICD of CHO cells with a mutant .

  • Immunoblotting: This technique is used to detect AMPylated proteins and assess the impact of mutations on BiP AMPylation .

  • Immunopurification: This technique is used to confirm the identity of AMPylated BiP by performing assays on BiP immunopurified from cells with a BiP-specific antibody .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
ficd; Protein adenylyltransferase FICD; AMPylator FICD; De-AMPylase FICD; FIC domain-containing protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
ficd
Target Protein Sequence
MAVTECEWASLGSRIGLRAALVLLSGSLLVVLFPLSGLEHQYRTALNILLQCNLWGGDDR HTFTGQTRGLAVASTAIELLVLKQKPTSDVKFEAKAALNQALEMKRQGKKEKAHKLLHHA LKMDPDHVDALNELGILLEEEKDIIQADYLYSKALTISPHNEKALINRDRTLPLVEEIDQ RYFSLIDSKVKKLMSIPKGNPALRRVMEESYYHHIYHTVAIEGNTLSLSEIRHIIETRYA VPGKSLEEQNEVIGMHAAMKYVNATLVSRIGSVTIDNILEIHRRILGYVDPVEAGRFRRN QVFVGHHIPPHPRDVEKLMQEFVQWLNSEEAMSLHPVEFAALAHYKLVYIHPFVDGNGRT SRLLMNLILMQAGYPPITVRKEQRSEYYHVLEIANEGDVRPFIRFIAKCTESTLDLLLIA TAEHPVGLPEPNHGFSECKQTITIKT
Uniprot No.

Target Background

Function

This protein functions as a dual-acting enzyme, mediating both the addition (AMPylation) and removal (de-AMPylation) of adenosine 5'-monophosphate (AMP) to/from target proteins. The activity (AMPylation or de-AMPylation) is determined by Glu-222. It critically regulates the ERN1/IRE1-mediated unfolded protein response (UPR) by modulating the AMPylation/de-AMPylation status of HSPA5/BiP. Under normal cellular conditions, it AMPylates HSPA5/BiP at Thr-518, leading to inactivation. In response to endoplasmic reticulum stress, it de-AMPylates HSPA5/BiP at Thr-518, thereby restoring HSPA5/BiP activity.

Database Links
Protein Families
Fic family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.

Q&A

What is FICD and what is its primary function in Xenopus tropicalis?

FICD (Fic domain-containing protein) in Xenopus tropicalis functions as a bifunctional enzyme capable of both AMPylation and deAMPylation of target proteins, particularly BiP (GRP78), a major endoplasmic reticulum chaperone. This post-translational modification regulates BiP activity during cellular homeostasis and stress responses. The enzymatic activity of FICD is critical for proper proteostasis in the ER, as excessive AMPylation has been shown to be lethal in model organisms . X. tropicalis, as a diploid amphibian with a sequenced genome showing remarkable synteny with mammalian genomes, provides an excellent vertebrate model for studying FICD function in a system that effectively bridges evolutionary gaps between simpler models and mammals .

How does Xenopus tropicalis compare to other model systems for studying FICD function?

Xenopus tropicalis offers several advantages for FICD research compared to other model systems. Unlike Xenopus laevis, which has an allotetraploid genome, X. tropicalis possesses a diploid genome that simplifies genetic analyses and mutation studies . Its genome shows greater synteny with mammalian genomes than teleost fish models, making it more relevant for translational research. The relatively short generation time (4-6 months) compared to X. laevis (12-18 months) facilitates multigenerational experiments, including the establishment of transgenic and mutant lines . Additionally, the well-established embryological techniques in Xenopus systems allow for tissue-specific manipulations and chimeric experiments that can help determine whether FICD-related phenotypes are cell-autonomous or due to failure in inductive signals from adjacent tissues .

What expression systems are most effective for producing recombinant X. tropicalis FICD?

For recombinant X. tropicalis FICD production, bacterial expression systems using E. coli (particularly BL21(DE3) strains) prove effective for basic biochemical studies, though eukaryotic systems may better preserve post-translational modifications and folding. When using bacterial systems, optimal expression is typically achieved at lower temperatures (16-18°C) with IPTG induction concentrations of 0.1-0.5 mM to enhance protein solubility. For functional studies requiring proper folding and modification, baculovirus-insect cell systems often yield higher quality protein. Purification typically employs affinity chromatography using His-tagged constructs followed by size exclusion chromatography to obtain homogeneous protein preparations. Expression in X. tropicalis cells themselves provides the most physiologically relevant system, though with lower yield than heterologous systems. For complex structure-function studies, mammalian cell expression (HEK293 or CHO cells) may be necessary to ensure proper folding and post-translational modifications that affect enzymatic activity.

What are the established protocols for measuring FICD AMPylation and deAMPylation activity in vitro?

In vitro assessment of X. tropicalis FICD enzymatic activities requires distinct experimental approaches for measuring both AMPylation and deAMPylation. For AMPylation assays, recombinant FICD is incubated with purified substrate (typically BiP/GRP78) in the presence of ATP (or [α-32P]ATP for radiometric detection) in a buffer containing Mg2+ at pH 7.5. The reaction products are typically analyzed by SDS-PAGE followed by autoradiography when using radiolabeled ATP, or by Western blotting using anti-AMP-threonine antibodies .

For deAMPylation assays, pre-AMPylated BiP (either radiolabeled [32P]AMP-BiP or non-labeled) is incubated with recombinant wild-type FICD under similar buffer conditions. The reaction progress is monitored by the decrease in AMPylation signal over time using either autoradiography or Western blotting . As demonstrated with other Fic proteins, wild-type FICD exhibits concentration-dependent deAMPylation activity, while catalytically inactive mutants (equivalent to Fic H375A) show no deAMPylation capacity . Both activities are typically time and concentration-dependent, with deAMPylation assays requiring careful time course analysis to determine reaction kinetics.

How can FICD activity be monitored in Xenopus tropicalis cells and tissues?

Treatment paradigms that modulate ER stress can be employed to observe dynamic changes in FICD activity. For example, cyclohexamide treatment reduces ER stress by halting protein translation, resulting in increased BiP AMPylation, while DTT treatment induces ER stress and triggers BiP deAMPylation . These experimental manipulations, combined with the detection methods described above, allow researchers to assess FICD activity under various physiological and stress conditions in X. tropicalis models.

What strategies exist for generating FICD mutants in Xenopus tropicalis?

Multiple complementary approaches exist for generating FICD mutants in X. tropicalis, each with specific advantages. CRISPR/Cas9 genome editing represents the most direct approach for creating precise mutations. This method involves microinjecting Cas9 protein or mRNA along with target-specific guide RNAs into fertilized X. tropicalis eggs, followed by screening F0 mosaic founders and establishing stable F1 lines through outcrossing. Mutation efficiency can be enhanced using homology-directed repair templates containing the desired mutation.

Transgenic approaches offer alternatives, particularly for tissue-specific or conditional expression of mutant FICD. These include both traditional transgenesis using restriction enzyme-mediated integration (REMI) and Tol2 transposon-based systems that allow integration of larger constructs with higher efficiency . For studying specific mutations analogous to those characterized in other systems (such as constitutively active E247G or catalytically dead H375A equivalents), researchers can employ tissue-specific promoters to express these variants in defined developmental contexts .

X. tropicalis' diploid genome significantly simplifies mutation recovery and analysis compared to the allotetraploid X. laevis, facilitating positional cloning approaches for identifying mutations . Additionally, gynogenetic screening methods can accelerate the identification of chromosome locations for FICD mutations, as successfully demonstrated for other genes in X. tropicalis .

How conserved is FICD structure and function between Xenopus tropicalis and mammalian systems?

X. tropicalis FICD shows remarkable structural and functional conservation with mammalian orthologs, reflecting the broader genomic synteny observed between X. tropicalis and mammals . The canonical Fic domain features a conserved HPFx(D/E)GNGR motif critical for AMPylation activity, with the histidine residue (equivalent to H375 in Drosophila) serving as the catalytic residue. The inhibitory α-helix containing a glutamate residue (equivalent to E247 in Drosophila) is also conserved, regulating the switch between AMPylation and deAMPylation activities .

Functionally, X. tropicalis FICD demonstrates the same dual enzymatic capacity observed in mammalian systems, capable of both AMPylation and deAMPylation of BiP on conserved threonine residues. The regulatory mechanisms governing this switch appear conserved as well, including the role of dimerization in modulating enzymatic preference . This high degree of conservation makes X. tropicalis an excellent model for studying FICD biology with direct relevance to mammalian systems. The regulatory role of FICD in ER stress responses through BiP modification also appears to be an evolutionarily ancient mechanism conserved from amphibians to mammals, underscoring its fundamental importance in proteostasis regulation.

What are the key differences between FICD and other Fic domain-containing proteins?

FICD belongs to the Fic (filamentation induced by cAMP) protein family but exhibits several distinguishing features compared to other family members. Most notably, vertebrate FICDs like those in X. tropicalis possess an N-terminal transmembrane domain that anchors them to the ER membrane, with the catalytic domain facing the ER lumen - a feature absent in many bacterial Fic proteins. This localization is crucial for FICD's role in regulating BiP activity during ER stress responses.

The table below summarizes key differences between FICD and other Fic proteins:

FeatureFICDOther Fic Proteins
LocalizationER membrane-anchoredCytoplasmic, secreted, or bacterial
Primary substrateBiP/GRP78Varies (GTPases, histones, etc.)
ModificationAMPylation at threonine residuesAMPylation, UMPylation, phosphocholination
Regulatory mechanismAuto-inhibition via α-helix, dimerizationVaries by family member
Demodification activityStrong deAMPylation activityVariable or absent
Stress responseRegulates UPR and ER stressDiverse functions, often pathogen-related

Unlike many bacterial Fic proteins that function primarily in host-pathogen interactions, vertebrate FICDs like those in X. tropicalis serve crucial homeostatic functions in regulating protein folding capacity during fluctuating cellular demands . The bifunctional nature of FICD (both AMPylating and deAMPylating) also distinguishes it from some Fic family members that possess only AMPylation activity.

How does the expression pattern of FICD vary across Xenopus tropicalis development?

FICD expression in X. tropicalis follows a dynamic pattern throughout development, reflecting its importance in managing ER proteostasis during different developmental stages. During early embryogenesis, maternal FICD transcripts are present in fertilized eggs, suggesting a role in early protein quality control. As development progresses, FICD expression patterns become more tissue-specific, with particularly strong expression in tissues with high secretory demands.

Tissues with active protein secretion (pancreas, liver, neural tissues) show enhanced FICD expression, correlating with elevated BiP levels. This tissue-specific expression pattern allows for targeted regulation of ER capacity in cells experiencing variable folding demands. Developmental transitions requiring extensive tissue remodeling (such as metamorphosis in X. tropicalis) are accompanied by significant changes in FICD expression profiles, suggesting its involvement in managing ER stress during these critical periods.

The ability to create tissue-specific chimeras in X. tropicalis enables detailed analysis of whether FICD expression and function are cell-autonomous or dependent on inductive signals from adjacent tissues . This approach has proven valuable for understanding the developmental context of gene function in X. tropicalis and could provide important insights into FICD's role during specific developmental transitions.

How does dimerization affect FICD enzymatic activities?

Dimerization plays a critical regulatory role in modulating the dual enzymatic activities of FICD. Studies with related Fic proteins demonstrate that dimerization state directly influences the balance between AMPylation and deAMPylation activities . Loss of dimerization capacity increases AMPylation activity while simultaneously reducing deAMPylation capability . This suggests that the monomeric and dimeric forms of FICD may preferentially catalyze different reactions.

The molecular basis for this regulation likely involves conformational changes in the active site that occur upon dimerization. In the dimeric state, structural rearrangements may favor positioning of the catalytic residues optimal for deAMPylation activity. Conversely, the monomeric form may adopt a conformation more conducive to ATP binding and AMPylation. This intricate regulation through oligomeric state provides a mechanism for rapidly switching FICD's activity in response to changing cellular conditions without requiring new protein synthesis.

Experimental approaches for studying this phenomenon include size exclusion chromatography to assess oligomeric state, analytical ultracentrifugation for precise determination of molecular weight, and mutation of residues at the dimer interface to create obligate monomers. These dimerization-deficient mutants can then be compared with wild-type FICD in both AMPylation and deAMPylation assays to quantify the impact of dimerization on enzymatic preferences.

What is the relationship between FICD activity and ER stress response in Xenopus tropicalis?

FICD activity exhibits a reciprocal relationship with ER stress in X. tropicalis cells, similar to observations in other model systems. During homeostatic conditions with low ER stress, FICD predominantly functions as an AMPylase, modifying BiP at conserved threonine residues. This AMPylation reduces BiP's ATPase activity and client binding, effectively creating a reserve pool of chaperone capacity .

When ER stress occurs (for example, during treatments that disrupt protein folding like DTT), FICD rapidly switches to its deAMPylation mode, removing AMP moieties from BiP and thereby activating the chaperone to manage the increased folding demand . This dynamic regulation is evidenced by increased BiP AMPylation during cyclohexamide treatment (which reduces ER stress by halting protein translation) and decreased AMPylation during DTT treatment (which induces ER stress) .

The unfolded protein response (UPR) further modulates this system through transcriptional regulation of both FICD and BiP, creating a multilayered regulatory network. This relationship between FICD activity and ER stress can be experimentally investigated in X. tropicalis cells using various stressors (tunicamycin, thapsigargin, DTT) followed by assessment of BiP AMPylation status and cell viability. The simplified genetic background of X. tropicalis facilitates the creation of FICD mutant lines to directly test the importance of this regulatory mechanism during development and stress responses .

How do FICD mutations affect Xenopus tropicalis development and physiology?

Mutations in FICD can profoundly impact X. tropicalis development and physiology, particularly through disruption of ER proteostasis. Based on studies in other model organisms, constitutively active FICD mutants (equivalent to the E247G mutant in Drosophila) would be expected to cause excessive BiP AMPylation, reducing available chaperone capacity and potentially causing developmental defects or lethality . The tissue-specific nature of these effects can be investigated in X. tropicalis using directed expression systems, as demonstrated by the rough and reduced eye phenotype observed when constitutively active Fic was expressed specifically in Drosophila eyes .

Conversely, catalytically inactive FICD mutants might disrupt the normal cycling of BiP between AMPylated and deAMPylated states, potentially impairing adaptive responses to fluctuating protein folding demands during development. The specific developmental consequences would likely vary by tissue, with secretory tissues being particularly sensitive to disruptions in ER proteostasis.

X. tropicalis offers unique advantages for studying these developmental effects through techniques like tissue-specific gene expression, creation of stable transgenic lines, and the ability to generate tissue chimeras to determine cell autonomy of observed phenotypes . The shorter generation time of X. tropicalis compared to X. laevis facilitates multigenerational experiments necessary for establishing and analyzing stable mutant lines .

How can X. tropicalis FICD be used to study ER stress adaptation mechanisms?

X. tropicalis FICD provides an excellent tool for investigating ER stress adaptation mechanisms across evolutionary contexts. Researchers can generate conditional or inducible FICD mutant lines to manipulate BiP activity states at specific developmental stages or in particular tissues. By combining these genetic tools with the classical embryological advantages of the Xenopus system, researchers can trace the consequences of disrupted proteostasis through development with exceptional spatial and temporal resolution.

For sophisticated mechanistic studies, CRISPR/Cas9-engineered X. tropicalis lines expressing fluorescently tagged FICD and BiP can enable real-time visualization of their dynamics during stress responses. The diploid genome of X. tropicalis simplifies the generation and analysis of these genetic modifications compared to the allotetraploid X. laevis . Additionally, the ability to perform high-throughput embryological manipulations in X. tropicalis facilitates screening for genetic and chemical modifiers of FICD function, potentially identifying novel components of ER stress adaptation pathways.

The remarkable degree of synteny between X. tropicalis and mammalian genomes enhances the translational relevance of these studies . Insights gained from X. tropicalis models can inform our understanding of human ER stress-related diseases, including neurodegenerative disorders, diabetes, and certain cancers where disrupted proteostasis plays a pathogenic role.

What advanced structural techniques provide insights into X. tropicalis FICD mechanisms?

Advanced structural techniques offer crucial insights into the mechanistic details of X. tropicalis FICD function. X-ray crystallography of recombinant FICD in different states (apo, nucleotide-bound, substrate-bound) can reveal conformational changes associated with catalysis and regulation. Comparison of structures with and without the inhibitory α-helix provides information on auto-regulatory mechanisms, while co-crystallization with BiP peptides can identify specific interaction surfaces.

Cryo-electron microscopy (cryo-EM) is particularly valuable for visualizing larger complexes, such as FICD dimers or FICD-BiP interactions, providing insights into how dimerization affects enzymatic activity . Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map conformational dynamics and solvent accessibility changes during catalysis or upon dimerization, complementing static structural information.

These structural approaches, combined with site-directed mutagenesis and functional assays, create a powerful platform for dissecting the molecular mechanisms underlying FICD's dual enzymatic activities and their regulation.

How can mass spectrometry be optimized for studying FICD-mediated modifications in X. tropicalis?

Optimizing mass spectrometry (MS) for studying FICD-mediated modifications in X. tropicalis requires specialized approaches to detect and quantify AMPylated proteins. Bottom-up proteomics using LC-MS/MS after tryptic digestion can identify specific AMPylation sites on BiP and potentially discover novel FICD substrates. For such analyses, enrichment strategies are crucial given the substoichiometric nature of most AMPylation events.

Immunoprecipitation using anti-AMP-threonine antibodies followed by MS analysis provides one enrichment approach . Alternatively, metabolic labeling with heavy isotope-labeled ATP can facilitate identification of newly AMPylated peptides. Parallel reaction monitoring (PRM) or multiple reaction monitoring (MRM) approaches enable sensitive, targeted quantification of AMPylated peptides across different experimental conditions.

The following table outlines key mass spectrometry approaches for studying FICD-mediated modifications:

MS ApproachApplicationAdvantagesConsiderations
Shotgun proteomicsDiscovery of novel FICD substratesUnbiased, comprehensiveLimited sensitivity for low-abundance modifications
Targeted proteomics (PRM/MRM)Quantification of known AMPylation sitesHigh sensitivity, quantitativeRequires prior knowledge of modification sites
Top-down proteomicsAnalysis of intact AMPylated proteinsPreserves combinatorial PTM informationTechnically challenging for larger proteins
Crosslinking MSMapping FICD-substrate interaction surfacesIdentifies transient interactionsComplex data analysis
Thermal proteome profilingIdentifying proteins affected by FICD activityCell-wide, functional readoutIndirect measure of AMPylation

For comprehensive analysis, researchers should consider temporal dynamics by collecting samples at various timepoints after stress induction or resolution. Comparison between wild-type and FICD mutant X. tropicalis tissues can further validate identified targets and provide insights into the biological significance of these modifications.

What are the main challenges in studying X. tropicalis FICD and potential solutions?

Several significant challenges exist in studying X. tropicalis FICD, each requiring specific methodological solutions. First, detecting AMPylation in vivo remains technically demanding due to the substoichiometric nature of the modification and limitations in antibody specificity. This can be addressed by developing more sensitive detection methods, including phosphoproteomics-inspired enrichment strategies and targeted mass spectrometry approaches.

Second, distinguishing between AMPylation and deAMPylation activities in complex biological contexts presents difficulties. Researchers can overcome this by designing time-course experiments with appropriate controls and by developing biosensors that report on BiP modification state in real-time. The ability to perform tissue-specific genetic manipulations in X. tropicalis facilitates teasing apart these complex dynamics in defined cellular contexts .

Third, the field lacks comprehensive understanding of the signaling pathways that regulate FICD activity switching. Genetic screens in X. tropicalis, facilitated by its diploid genome and established mutagenesis protocols, can identify novel regulators . X. tropicalis' position as a tetrapod with significant genome synteny to mammals enhances the translational relevance of such discoveries .

Lastly, establishing direct connections between FICD activity and specific developmental or physiological outcomes requires sophisticated in vivo models. The ability to create tissue chimeras and perform lineage tracing in X. tropicalis provides powerful approaches for addressing these questions .

What emerging technologies will advance X. tropicalis FICD research?

Emerging technologies promise to significantly advance X. tropicalis FICD research in the coming years. CRISPR-based technologies beyond gene knockout, including base editing and prime editing, will enable precise manipulation of specific residues in the endogenous FICD gene without the need for homology-directed repair. This will facilitate the creation of subtle mutations that affect specific aspects of FICD function without completely abolishing activity.

Optical control technologies, such as optogenetic tools adapted for FICD, could allow temporal and spatial control of FICD activity with unprecedented precision. This would enable researchers to trigger AMPylation or deAMPylation events in specific tissues during defined developmental windows, providing insights into acute versus chronic effects of altered proteostasis.

Single-cell transcriptomics and proteomics applied to X. tropicalis embryos and tissues will reveal cell type-specific responses to FICD manipulation, potentially identifying distinct vulnerability patterns across different cellular populations. When combined with spatial transcriptomics/proteomics approaches, these technologies could map the tissue-specific consequences of altered FICD activity throughout development.

The development of selective small molecule modulators of FICD activity would complement genetic approaches, allowing rapid and reversible manipulation of FICD function. High-throughput screening platforms using X. tropicalis cell lines could facilitate the discovery of such compounds. These chemical tools would be particularly valuable for distinguishing between developmental versus acute physiological roles of FICD.

How might X. tropicalis FICD research inform therapeutic strategies for ER stress-related diseases?

Research on X. tropicalis FICD has significant potential to inform therapeutic strategies for ER stress-related diseases in humans. The high degree of conservation in both sequence and function between X. tropicalis and mammalian FICD, coupled with the remarkable synteny between their genomes, makes insights from this model system directly relevant to human health applications .

By elucidating the precise mechanisms regulating the switch between AMPylation and deAMPylation activities, researchers can identify potential intervention points for modulating ER chaperone capacity in diseases characterized by proteostasis disruption. Forward genetic screens in X. tropicalis, facilitated by its diploid genome, could identify novel regulators of FICD activity that represent promising drug targets .

The ability to perform tissue-specific manipulation of FICD activity in X. tropicalis provides a platform for understanding tissue-selective vulnerability to ER stress, potentially explaining why certain tissues are preferentially affected in specific ER stress-related disorders. This information could guide the development of tissue-targeted therapeutic approaches that modulate FICD activity only where needed, minimizing side effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.