Recombinant Xenopus tropicalis ATPase family AAA domain-containing protein 3 (atad3)

What is ATAD3 and why is it significant for mitochondrial research?

ATAD3 (ATPase family AAA domain-containing protein 3) is a unique mitochondrial protein that evolved deep in the eukaryotic lineage but is notably absent in Fungi and Amoebozoa. These approximately 600-amino acid proteins are anchored in the inner mitochondrial membrane and are essential in metazoans including Xenopus species and other organisms such as Drosophila, Caenorhabditis elegans, mammals, and Arabidopsis thaliana. The significance of ATAD3 stems from its essential nature, as ATAD3 defects are linked to multiple mitochondrial-based human diseases. The protein's unique structure and positioning within mitochondria make it particularly valuable for studying mitochondrial membrane dynamics, protein quality control, and inter-organelle communication .

What are the major structural domains of ATAD3 proteins?

ATAD3 proteins comprise two major structural domains with distinct functions:

• C-terminal AAA+ (ATPases Associated with various cellular Activities) domain: Located in the mitochondrial matrix, this domain contains conserved motifs including the Walker A motif (responsible for binding the γ-phosphate of ATP) and the Walker B motif (which coordinates the magnesium ion essential for ATP hydrolysis). Additional features include Sensor 1, an Arginine finger, and Sensor 2 .

• ATAD3_N domain: Previously designated as DUF3523 (Domain of Unknown Function), this domain shows no homology to other known proteins and is unique to ATAD3s. Structural predictions indicate it comprises an intrinsically disordered amino terminus followed by α-helical segments. This domain is primarily located in the intermembrane space between the inner and outer mitochondrial membranes .

• Connecting region: Between these two major domains lie two predicted short helices separated by four to six amino acids. The more C-terminal helix is a transmembrane helix, while the more N-terminal helix is amphipathic and considered "membrane active" .

How is ATAD3 targeted to mitochondria?

Unlike many mitochondrial proteins, ATAD3 lacks an N-terminal mitochondrion-targeting peptide. Instead, between the transmembrane helix and the start of the AAA+ domain, there is an 18-amino acid sequence that has been identified as an internal targeting sequence. This region shows significant sequence conservation even between Arabidopsis thaliana and human ATAD3s, suggesting evolutionary importance of this targeting mechanism .

What expression systems are optimal for producing recombinant Xenopus tropicalis ATAD3?

For recombinant Xenopus tropicalis ATAD3 production, bacterial expression systems (particularly E. coli) are commonly employed for basic structural studies, while eukaryotic expression systems like insect cells or mammalian cells are preferable when post-translational modifications are critical. The choice depends on research objectives:

• E. coli systems: Higher yield but may lack proper folding for complex domains

• Insect cell systems: Better for preserving structural integrity of multi-domain proteins

• Mammalian cell systems: Optimal for studies requiring native-like post-translational modifications

When designing expression constructs, it's important to consider that ATAD3 has a unique topology spanning both mitochondrial membranes. Expression of functional domains separately (AAA+ domain or ATAD3_N domain) may sometimes be more effective than attempting to express the full-length protein .

What purification challenges are specific to recombinant ATAD3 proteins?

Purification of recombinant ATAD3 presents several challenges due to its unique structural properties:

• Membrane association: The transmembrane domain makes ATAD3 difficult to solubilize without affecting protein structure.

• Oligomerization tendency: ATAD3 proteins form dimers or higher-order oligomers through their ATAD3_N domain, which may result in aggregation during purification.

• Stability concerns: The intrinsically disordered regions within the ATAD3_N domain can contribute to protein instability during purification processes.

For optimal results, a multi-step purification protocol is recommended:

• Initial affinity chromatography (His-tag or other fusion tag)

• Ion exchange chromatography to remove contaminants

• Size exclusion chromatography to separate monomeric, dimeric, and oligomeric forms

• Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C to maintain stability, while avoiding repeated freeze-thaw cycles .

What quantity of recombinant ATAD3 is typically required for different experimental applications?

The required quantity of recombinant Xenopus tropicalis ATAD3 varies by application:

Commercial preparations typically provide 50 μg per vial, which is suitable for most standard biochemical assays but may require pooling of multiple vials for structural studies or extensive interaction analyses .

What evidence supports ATAD3's role in mitochondrial protein quality control?

Several lines of evidence implicate ATAD3 in mitochondrial protein quality control:

• Structural homology: The AAA+ domain of ATAD3 shows highest structural similarity to classic chaperone unfoldases in the AAA+ family. Using structural modeling servers like Phyre2, ATAD3A1 AAA+ domain structurally aligns with proteins involved in protein remodeling, such as mouse p97/vcp, yeast afg2, yeast cdc48, and proteasome-activating ATPases .

• Template structural files: AlphaFold models for ATAD3 proteins are derived using templates that include human AFGL3, human TRIP13, human 26S proteasome subunits, and bacterial FtsH proteins - all involved in protein unfolding or remodeling .

• Phenotypic evidence: In Arabidopsis, disruption of ATAD3 results in aberrant mitochondrial morphology and reduced complex I assembly, suggesting a role in maintaining proper protein folding and assembly within mitochondria .

• Co-expression patterns: ATAD3 genes are co-expressed with mitochondrial chaperones such as Lon1 and mitochondrial Hsp70-1, further supporting their role in protein quality control networks .

These observations collectively suggest that ATAD3 functions as a unique component of the mitochondrial protein quality control network, potentially involved in unfolding or remodeling substrate proteins.

How does the unique topology of ATAD3 contribute to its function?

The unique topology of ATAD3 plays a critical role in its proposed functions:

• Trans-membrane positioning: ATAD3 is the only known mitochondrial protein with a structure spanning both the inner and outer mitochondrial membranes, with its C-terminus in the matrix and potentially the N-terminus exposed to the cytosol. This unique positioning allows it to:

  • Communicate mitochondrial status to the rest of the cell

  • Potentially mediate interactions between mitochondria and other organelles

  • Participate in contact sites between inner and outer mitochondrial membranes

• ATAD3_N domain structure: The helical structure of this domain is calculated to be approximately 20 nm long, sufficient to span the estimated distance between the two mitochondrial membranes outside of contact sites. This enables ATAD3 to function as a structural scaffold .

• Cytosolic accessibility: Evidence suggests the N-terminus is accessible to the cytosol:

  • Antibodies specific for the first N-terminal 50 amino acids react with intact mitochondria

  • ATAD3 has been recovered by immunoprecipitation with Dynamin-related protein 1 (DRP1)

  • Arginylation (a cytosolic modification) has been detected on ATAD3 in Physcomitrella patens

This unique topology positions ATAD3 to potentially serve as a communicator between mitochondria and other cellular compartments, particularly at ER-mitochondrial contact sites.

What phenotypes result from ATAD3 disruption in model organisms?

Disruption of ATAD3 produces several characteristic phenotypes across model organisms:

In Arabidopsis thaliana:

• Single mutant T-DNA insertion alleles show no obvious morphological differences

• Double mutants lacking both genes from either the A or B clade are not viable

• Partially rescued mutants exhibit:

  • Slower growth

  • Reduced complex I with accumulation of assembly intermediates

  • Normal levels of complexes III and V

  • Enhanced acclimation to high temperature

  • Heterogeneous mitochondrial morphology with many enlarged mitochondria

  • Disrupted nucleoids that fill the whole organelle rather than appearing as discrete puncta

In metazoans (compiled from literature cited in search results):

• Mitochondrial DNA replication and distribution defects

• Altered lipid metabolism

• Impaired oxidative phosphorylation

• Changes in mitochondrial nucleoid structure

• Loss of cristae structure

These pleiotropic effects across different organisms indicate that ATAD3 plays fundamental roles in mitochondrial structure and function, particularly in maintaining nucleoid organization and respiratory complex assembly.

How does Xenopus tropicalis ATAD3 differ from ATAD3 proteins in other species?

Xenopus tropicalis ATAD3 (UniProt: Q6NVR9) shares the fundamental domain organization of other ATAD3 proteins but exhibits species-specific characteristics:

• Sequence conservation: The AAA+ domain shows higher conservation across species compared to the ATAD3_N domain, which shows greater variation. This pattern is consistent with the functional constraints on the AAA+ domain versus the potentially more adaptable role of the N-terminal region .

• Amino acid sequence: The N-terminal portion of Xenopus tropicalis ATAD3 begins with the sequence "MSWLFGLNKGQQGPPSVPGFPEPPSPPGGSGDGGDKNKPKDKWSNFDPTGLERAAKAARE LDQSRHAKEA" . This region contains the disordered N-terminus that is characteristic of ATAD3 proteins.

• Evolutionary context: As an amphibian model, Xenopus tropicalis ATAD3 represents an important evolutionary position between fish and mammals, potentially providing insights into the functional adaptation of ATAD3 during vertebrate evolution .

Comparative analysis between Xenopus ATAD3 and mammalian ATAD3 can provide valuable insights into conserved functional domains and species-specific adaptations of this essential protein.

What experimental advantages does Xenopus tropicalis offer for studying ATAD3 function?

Xenopus tropicalis provides several experimental advantages for ATAD3 research:

• Developmental biology: The external development and large embryo size of Xenopus make it ideal for studying ATAD3's role during embryonic development and organogenesis, when mitochondrial biogenesis is highly active.

• Cell-free systems: Xenopus egg extracts serve as powerful biochemical systems for studying mitochondrial protein import and assembly, allowing detailed mechanistic studies of ATAD3 incorporation into mitochondrial membranes.

• Genetic manipulations: With the advent of CRISPR/Cas9 technology, Xenopus tropicalis has become amenable to precise genetic modifications, enabling the creation of ATAD3 mutant lines to study its function in vivo.

• Evolutionary insights: As a tetrapod with a relatively compact genome, Xenopus tropicalis offers insights into the evolutionary conservation of ATAD3 function between aquatic and terrestrial vertebrates.

• Mitochondrial visualization: The large cells in Xenopus embryos and tissues facilitate high-resolution imaging of mitochondrial structures and dynamics, allowing detailed analysis of how ATAD3 affects mitochondrial morphology and nucleoid organization.

These advantages position Xenopus tropicalis as a valuable model organism for both biochemical and developmental studies of ATAD3 function.

How can recombinant ATAD3 be used to investigate protein-protein interactions at mitochondrial membranes?

Recombinant Xenopus tropicalis ATAD3 can be employed in several advanced techniques to investigate protein-protein interactions:

• Cross-linking mass spectrometry (XL-MS): By using chemical cross-linkers with recombinant ATAD3 incubated with mitochondrial extracts, researchers can identify proximity relationships between ATAD3 and other proteins. This technique is particularly valuable for identifying transient or weak interactions at membrane interfaces.

• Proximity-dependent biotinylation: Fusion of recombinant ATAD3 with promiscuous biotin ligases (BioID or TurboID) allows for identification of proteins in close proximity to different domains of ATAD3. This approach can help distinguish interaction partners of the matrix-facing AAA+ domain versus the intermembrane space-facing ATAD3_N domain .

• Reconstitution systems: Purified recombinant ATAD3 can be incorporated into liposomes or nanodiscs to study its interactions with specific lipids and proteins in a controlled environment. This approach is particularly useful for investigating ATAD3's role at membrane contact sites.

• Pull-down assays with domain-specific mutations: By generating recombinant ATAD3 with specific mutations in either the AAA+ domain or ATAD3_N domain, researchers can distinguish which domains mediate specific protein interactions, such as those reported with mitochondrial fission GTPase DRP1 .

These approaches can help elucidate ATAD3's reported associations with proteins at both ER-mitochondrial contact sites and inner-outer mitochondrial membrane contact sites.

What are the challenges in determining the essential roles of ATAD3 in mitochondria?

Several challenges complicate the determination of ATAD3's essential functions:

• Pleiotropic effects of disruption: ATAD3 disruption causes multiple effects ranging from reduced oxidative phosphorylation to altered lipid metabolism and nucleoid disorganization, making it difficult to distinguish primary from secondary effects .

• Unique topology: The unusual membrane topology of ATAD3, potentially spanning both mitochondrial membranes, presents technical challenges for structural studies and functional reconstitution experiments .

• Redundancy and compensation: In organisms with multiple ATAD3 genes (like Arabidopsis with four genes), functional redundancy complicates genetic analysis. Single mutants may show no phenotype while certain combinations are lethal, suggesting complex functional relationships between ATAD3 paralogs .

• Technical limitations: The essential nature of ATAD3 makes it difficult to study complete loss-of-function phenotypes, as these are often lethal. Researchers must rely on partial knockdowns, conditional systems, or partially complemented mutants .

• Diverse potential functions: The implication of ATAD3 in multiple processes (protein quality control, membrane contacts, nucleoid organization) necessitates multidisciplinary approaches to fully understand its functions.

Addressing these challenges requires integrated approaches combining structural biology, biochemistry, genetics, and advanced imaging techniques to dissect the complex roles of ATAD3 in mitochondrial biology.

How can ATAD3 research contribute to understanding mitochondrial disease mechanisms?

ATAD3 research offers several avenues for understanding mitochondrial disease mechanisms:

• Disease associations: ATAD3 defects are linked to multiple mitochondrial-based human diseases. Understanding the molecular mechanisms of ATAD3 function could provide insights into pathological processes underlying these conditions .

• Mitochondrial complex assembly: ATAD3 disruption affects respiratory complex I assembly and function. Detailed mechanistic studies using recombinant ATAD3 could reveal how it contributes to the biogenesis and maintenance of respiratory complexes, which are frequently affected in mitochondrial diseases .

• Nucleoid organization: The role of ATAD3 in maintaining mitochondrial nucleoid structure connects it to mitochondrial DNA maintenance. This aspect is particularly relevant to mitochondrial diseases involving mtDNA deletions or depletion .

• Inter-organelle communication: ATAD3's potential role at ER-mitochondria contact sites positions it as a regulator of inter-organelle crosstalk, which is increasingly recognized as important in mitochondrial disease pathogenesis .

• Comparative studies: Research using Xenopus tropicalis ATAD3 alongside human ATAD3 can identify conserved functional domains that might be targeted for therapeutic development, as well as species-specific adaptations that might explain differential disease susceptibility.

By elucidating the fundamental roles of ATAD3 in mitochondrial biology, researchers can potentially identify new therapeutic targets and biomarkers for mitochondrial diseases.