Recombinant Xenopus tropicalis Blood vessel epicardial substance (bves)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus tropicalis Blood Vessel Epicardial Substance (bves)

Recombinant Xenopus tropicalis Blood Vessel Epicardial Substance (bves) is a protein derived from the Xenopus tropicalis species, a model organism widely used in developmental biology and genetics research. The protein, also known as Blood Vessel Epicardial Substance (BVES) or Popeye Domain-Containing Protein 1 (POPDC1), plays significant roles in cell adhesion, motility, and vesicular transport. The study of bves is crucial due to its implications in developmental processes and potential links to various diseases.

Characteristics of bves

Structure and Function

bves is characterized as a highly conserved transmembrane protein with a unique structure comprising three transmembrane domains. It features a short extracellular N-terminus and a larger intracellular C-terminus, which contains the Popeye domain—a motif believed to be important for its function. This protein exists as a homodimer in vivo, which is essential for its biological activity .

Expression Patterns

bves is expressed in various tissues including muscle, epithelial, and brain tissues, both during development and in adult organisms. Its dynamic localization is observed at cell junctions and intracellular vesicles, indicating its role in cellular interactions and adhesion .

Role of bves in Cellular Processes

Cell Adhesion and Motility

Research has shown that disruption of bves leads to impaired cell motility and adhesion, which are critical processes for proper tissue formation and maintenance. Specifically, bves interacts with proteins like GEFT that modulate Rho GTPase signaling pathways, affecting cellular morphology and movement .

Vesicular Transport

bves is also implicated in vesicular transport mechanisms through its interaction with VAMP3, a SNARE protein essential for vesicle fusion. Disruption of bves results in decreased integrin recycling and impaired exocytosis processes, further underscoring its role in cellular transport dynamics .

Research Findings on Recombinant bves

Developmental Studies

Studies utilizing Xenopus tropicalis as a model organism have highlighted the importance of bves in embryonic development. For instance, knockdown experiments have shown that loss of bves disrupts epidermal barrier functions and increases sensitivity to osmotic stress in zebrafish models .

Cancer Research Implications

Recent investigations have indicated that bves expression is silenced through promoter hypermethylation in various cancers, including colon, lung, and breast cancer. This underexpression occurs early during tumorigenesis, suggesting that bves may serve as a potential biomarker for cancer diagnosis or prognosis .

Comparative Analysis of bves Across Species

SpeciesProtein NameFunctionExpression Patterns
Xenopus tropicalisRecombinant bvesCell adhesion, motility, vesicular transportMuscle, epithelial, brain tissues
HumansBVES/POPDC1Similar roles as aboveHighly expressed in muscle and epithelial tissues
ZebrafishzBvesSimilar roles; affects epidermal barrierExpressed during development

References

  • PubMed articles on Xenopus tropicalis genetics .

  • Wikipedia entry on Blood Vessel Epicardial Substance .

  • Research articles discussing the role of bves in cellular functions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
bves; pop1; popdc1; Blood vessel epicardial substance; Popeye domain-containing protein 1; Popeye protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
bves
Target Protein Sequence
MATESILITTLPMDLNSQINNVTFGLNENETLCENWREIHHLVFHLANTCFAAGLVIPST LNLHMILLRGMLCLGCIFFIIWAILFRCALDIMIWNATFLSMNFMHFIYLVYKKRPIKIE KDLKGIYHRMFEPLHVSPELFNRLTGQFCEIKTLAKGQTYAIEDKTSVDDRLSILLKGIM KVSYRGHFLHAISPNAYIDSPEFRSTEMNRGETFQVTITADDNCVFLCWSRERLTYFLES EPFLYEIFKYLIGKDITTKLYSLNDPTLGKKKKLDTQPSLCSQLSVMEMRNSLASTSDNE DGLQTFLRGTSTTSSQRNNQQEFCNAYGVGPLSHAVFC
Uniprot No.

Target Background

Function

Blood vessel epicardial substance (BVES) is a cell adhesion molecule crucial for maintaining cell integrity. It may play a role in vamp3-mediated vesicular transport and receptor recycling. BVES may also be involved in regulating the tight junction (TJ) paracellular permeability barrier in epithelial cells, initiating epithelial cell adhesion and aggregation independently of Ca2+, and facilitating epithelial movement during corneal regeneration. Further, BVES potentially modulates cell shape and movement by influencing Rho-GTPase activity, and may contribute to skeletal muscle and heart development, heart function maintenance, striated muscle regeneration, and cell spreading regulation.

Database Links
Protein Families
Popeye family
Subcellular Location
Lateral cell membrane. Cell junction, tight junction. Membrane; Multi-pass membrane protein. Cell membrane, sarcolemma. Membrane, caveola.

Q&A

Advanced Research Questions

  • How can recombinant X. tropicalis BVES be used to study tight junction formation and regulation?

Recombinant X. tropicalis BVES provides a valuable tool for investigating tight junction dynamics through several experimental approaches:

  • Functional Rescue Studies:

    • Transfection of recombinant BVES into BVES-deficient cells to restore tight junction formation

    • Measurement of transepithelial electrical resistance (TEER) to quantify barrier function

    • Comparison of rescue efficiency between wild-type BVES (w-BVES) and truncated BVES (t-BVES)

    • Live-cell imaging to visualize junction assembly dynamics in real-time

  • Protein Interaction Analysis:

    • Pull-down assays using recombinant BVES to identify binding partners

    • Co-immunoprecipitation to verify interactions with known tight junction proteins

    • FRET or BRET assays to study dynamic protein-protein interactions

    • Domain mapping to identify specific regions required for tight junction association

  • Dominant Negative Approaches:

    • Expression of truncated BVES to disrupt endogenous BVES function

    • Analysis of competitive binding between full-length and truncated BVES forms

    • Assessment of tight junction protein mislocalization

Research has demonstrated that human corneal epithelial cells expressing full-length BVES (w-BVES) show increased tight junction function with higher transepithelial electrical resistance, while cells expressing truncated BVES (t-BVES) exhibit disrupted tight junction protein localization and decreased barrier function . These findings highlight how recombinant BVES variants can be used to dissect the structural requirements for proper tight junction assembly.

  • What experimental approaches can be used to investigate the role of BVES in RhoA signaling pathway in X. tropicalis?

Investigating BVES-mediated regulation of RhoA signaling requires sophisticated experimental designs:

  • RhoA Activity Measurement:

    • FRET-based biosensors for real-time visualization of RhoA activity in living cells

    • Rhotekin-RBD pull-down assays to quantify active GTP-bound RhoA

    • Phosphorylation analysis of RhoA downstream targets (ROCK, LIMK, cofilin)

    • Microscopy-based assessment of stress fiber formation as a readout of RhoA activation

  • Molecular Mechanism Investigation:

    • Analysis of GEF-H1 localization in response to BVES manipulation

    • Determination of ZONAB/DbpA transcriptional activity using reporter assays

    • Examination of tight junction protein dynamics and their influence on RhoA regulators

    • Co-localization studies of BVES with RhoA pathway components

  • Genetic Approaches in X. tropicalis:

    • CRISPR-Cas9 knockout of BVES in X. tropicalis embryos

    • Morpholino-based knockdown for stage-specific analysis

    • Transgenic expression of constitutively active or dominant negative RhoA

    • Rescue experiments with wild-type or mutant BVES constructs

Studies have shown that expression of truncated BVES (t-BVES) in epithelial cells leads to decreased membrane localization of GEF-H1 (a RhoA activator) and increased RhoA activity, with a significant 30% increase in FRET activity compared to control cells . This indicates that intact BVES normally suppresses RhoA activation, likely by regulating GEF-H1 localization at tight junctions.

  • How can researchers investigate the role of BVES in heart development using X. tropicalis embryos?

X. tropicalis provides an excellent model system for studying BVES function in cardiac development:

  • Expression Analysis:

    • Whole-mount in situ hybridization to visualize BVES expression during heart development

    • Immunohistochemistry to localize BVES protein in cardiac tissues

    • Single-cell RNA-seq to identify BVES-expressing cell populations

    • Quantitative RT-PCR to measure expression levels across developmental stages

  • Loss-of-Function Approaches:

    • CRISPR-Cas9 mediated knockout of BVES

    • Morpholino oligonucleotide injection for targeted knockdown

    • Dominant negative constructs (e.g., truncated BVES)

    • Pharmacological inhibition of BVES-dependent pathways

  • Phenotypic Analysis:

    • High-speed video microscopy to assess cardiac contraction and rhythm

    • Optical mapping to visualize cardiac conduction

    • Histological analysis to examine heart morphology

    • Molecular marker analysis to evaluate cardiac differentiation

  • Mechanistic Investigation:

    • Analysis of tight junction formation in developing cardiac tissues

    • Assessment of RhoA signaling during cardiogenesis

    • Examination of ZONAB/DbpA-regulated gene expression

    • Investigation of cell adhesion and migration during cardiac morphogenesis

Research in mice has shown that BVES is strongly expressed in the heart, particularly in the atria and cardiac conduction system . BVES knockout mice exhibit stress-induced sinus bradycardia and age-dependent sinoatrial node dysfunction reminiscent of sick sinus syndrome in humans . These findings suggest that X. tropicalis could serve as a valuable model for investigating the developmental origins of cardiac conduction disorders related to BVES dysfunction.

  • How does recombinant X. tropicalis BVES compare with human BVES in experimental settings?

Comparing X. tropicalis and human BVES reveals important similarities and differences that impact experimental design and interpretation:

FeatureX. tropicalis BVESHuman BVESExperimental Implications
Protein length338 amino acids ~360 amino acidsSlight differences in molecular weight
Functional domainsConserved Popeye domainConserved Popeye domainSimilar core functionality
Expression patternHeart, muscle, epitheliaHeart, muscle, GI tractComparable tissue distribution
Post-translational modificationsFewer modification sitesMore phosphorylation sitesPotential regulatory differences
Interaction partnersSome species-specific interactionsAdditional human-specific partnersDifferent experimental outcomes possible
Disease relevanceModel organism contextDirect clinical relevanceTranslation of findings requires validation
Antibody availabilityLimited X. tropicalis-specific optionsMore commercial antibodiesMay need custom antibodies for X. tropicalis work

When using X. tropicalis BVES as a model for human BVES function, researchers should:

  • Focus on conserved domains and functions

  • Validate key findings in human cell systems

  • Consider species-specific differences in expression patterns

  • Account for potential differences in binding partners

  • Perform cross-species rescue experiments to assess functional conservation

Despite these considerations, the core functions of BVES in tight junction regulation and signaling pathway modulation appear conserved between species, making X. tropicalis a valuable model for studying fundamental BVES mechanisms.

  • What methodological considerations are important when generating and using recombinant X. tropicalis BVES for research?

Producing and utilizing recombinant X. tropicalis BVES requires careful attention to several methodological aspects:

  • Expression System Selection:

    • Bacterial systems (E. coli): Cost-effective but may lack post-translational modifications

    • Insect cells (Sf9, Hi5): Better for membrane proteins with complex folding

    • Mammalian cells (HEK293, CHO): Provide most native-like modifications

    • Cell-free systems: Rapid production but limited scale

  • Construct Design:

    • Full-length vs. truncated versions for specific applications

    • Strategic placement of affinity tags to minimize functional interference

    • Inclusion of fluorescent protein fusions for localization studies

    • Codon optimization for the expression system

  • Purification Strategy:

    • Detergent selection for membrane protein solubilization

    • Affinity chromatography (His-tag, FLAG-tag, GST)

    • Size exclusion chromatography for removing aggregates

    • Ion exchange chromatography for increasing purity

  • Quality Control:

    • SDS-PAGE and Western blotting to verify size and purity

    • Mass spectrometry to confirm protein identity

    • Circular dichroism to assess secondary structure

    • Functional assays to verify activity (e.g., binding to known partners)

  • Storage and Handling:

    • Determine optimal buffer conditions to maintain stability

    • Assess freeze-thaw stability

    • Test long-term storage conditions

    • Evaluate the impact of lyophilization if applicable

For functional studies, researchers should compare wild-type BVES (w-BVES) with C-terminus truncated BVES (t-BVES), as previous research has shown distinct functional differences between these forms . The truncated version can serve as a valuable control or tool for dominant-negative approaches in experimental settings.

  • What are the current challenges and future directions in BVES research using the X. tropicalis model?

Research on BVES in X. tropicalis faces several challenges but also offers exciting opportunities for future investigation:

  • Current Technical Challenges:

    • Limited availability of X. tropicalis-specific antibodies and reagents

    • Need for specialized facilities for amphibian husbandry

    • Longer generation time compared to some other model organisms

    • Limited established transgenic lines for tissue-specific studies

  • Biological Complexities:

    • Potential redundancy with other Popeye domain-containing proteins

    • Species-specific differences in BVES expression and regulation

    • Complex tissue-specific roles across development

    • Integration of BVES function with other junctional signaling pathways

  • Emerging Research Opportunities:

    • Investigation of BVES in EMT and cancer progression

    • Role in cardiac conduction system development and disease

    • Function in gastrointestinal epithelial homeostasis and inflammation

    • Therapeutic targeting of BVES pathways in human disease

  • Methodological Advances:

    • CRISPR-Cas9 genome editing for precise genetic manipulation

    • High-throughput phenotypic screening approaches

    • Advanced imaging techniques for in vivo studies

    • Integration of -omics approaches for systems-level understanding

Resource centers like the National Xenopus Resource (NXR) and the European Xenopus Resource Centre (EXRC) are developing tools including CRISPR-Cas9 resources and transgenic lines that will accelerate BVES research in X. tropicalis . XenoBiores, run by the NBRP X. tropicalis, facilitates the exchange of questions and protocols among researchers , providing valuable support for addressing technical challenges.

Future research directions should leverage the unique advantages of X. tropicalis, including its diploid genome, developmental accessibility, and evolutionary position, to investigate BVES functions that are relevant to human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.