Recombinant Xenopus tropicalis Calcitonin gene-related peptide type 1 receptor (calcrl)

Shipped with Ice Packs
In Stock

Description

Ligand Specificity and RAMP Interactions

Calcrl requires RAMPs to form functional receptors:

  • RAMP1: Presents calcrl as a CGRP receptor with mature glycosylation .

  • RAMP2/3: Converts calcrl into an ADM receptor with core glycosylation .

Key findings from functional assays:

  • In HEK293T cells, calcrl co-expressed with RAMP3 exhibited EC₅₀ values of 1.84 nM for CGRP and 40.86 nM for ADM, highlighting ligand selectivity .

  • cAMP/PKA signaling is the primary pathway activated, with minimal calcium mobilization .

Signaling Pathways

PathwayActivation Mechanism
cAMP/PKADominant pathway; measured via CRE-luciferase reporters .
MAPK/ERKSecondary pathway linked to cell proliferation .

Experimental Models

  • CHO and HEK293T Cells: Used to study receptor trafficking, glycosylation, and ligand efficacy .

  • Luciferase Reporter Assays: Quantify cAMP production (e.g., EC₅₀/IC₅₀ calculations for agonists/antagonists) .

Biological Insights

  • Lymphatic Regulation: Calcrl signaling maintains lymphatic endothelial barrier integrity by stabilizing junctional proteins (ZO-1, VE-cadherin) .

  • Metabolic Roles: In Xenopus, calcrl-RAMP complexes modulate responses to dietary challenges, affecting nutrient absorption .

Comparative Analysis with Vertebrate Orthologs

SpeciesKey DifferenceCitation
HumanCALCRL-RAMP1 binds CGRP; CALCRL-RAMP2/3 binds ADM .
ChickenCLR-RAMP3 enhances CGRP sensitivity (EC₅₀: 4.31 nM) .
XenopusAM2/AM5 activate calcrl-RAMP3 with lower potency than CGRP .

Technical Considerations for Recombinant Use

  • Purity: ≥85% (SDS-PAGE verified) .

  • Storage: Lyophilized at -20°C; avoid repeated freeze-thaw cycles .

  • Activity Validation: Requires co-expression with RAMPs and functional assays (e.g., cAMP quantification) .

Implications for Biomedical Research

  • Drug Development: Calcrl is a target for migraine therapies (CGRP antagonists) and cardiovascular drugs (ADM agonists) .

  • Evolutionary Studies: Conservation of calcrl-RAMP interactions across vertebrates highlights its critical role in peptide hormone signaling .

References

  1. GeneCards CALCA/CALCRL summaries .

  2. Functional characterization in Xenopus and HEK293T cells .

  3. Structural insights from CGRP and AM studies .

  4. Technical specifications from recombinant protein vendors .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
calcrl; TEgg071c13.1; Calcitonin gene-related peptide type 1 receptor; CGRP type 1 receptor; Calcitonin receptor-like receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-472
Protein Length
Full Length of Mature Protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
Target Protein Sequence
EQEQGSQIPLEEIIQVGVTRNKIMTAQYECYQKIMQEPANGKEGHFCNRTWDGWLCWGDV SAGVISEQRCPDYFQDFDPSEKVTKECGKNGHWFRHPDSNRTWTNYTRCNTFTHEKVKTA LNLYYLTIIGHGLSIASLLISLGIFFYFKNLSCQRITLHKNLFFSFVCNSIITIISLSAV ANNQALVATNPVSCKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLL GWGFPLIPACIHAVARSLYYNDNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLIT KLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIAEEIYDYVMHILMHYQGL LVATIFCFFNGEVQAVLKRHWNQYKIQFGSSFAHSEGLRSASYTVSSISEIQGTTYTHDY SEQSNGKNCHDMENVFFKTEKQYM
Uniprot No.

Target Background

Function
This receptor binds calcitonin-gene-related peptide (CGRP), and its specificity can be modulated by accessory proteins. Signaling is mediated by G proteins which activate adenylyl cyclase.
Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should recombinant Xenopus tropicalis Calcrl be stored and handled for optimal stability?

For optimal stability and activity of recombinant Xenopus tropicalis Calcrl protein:

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (default recommendation: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

Buffer composition:

  • The protein is supplied in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein stability and activity .

What expression systems are used for producing recombinant Xenopus tropicalis Calcrl?

The recombinant Xenopus tropicalis Calcrl protein is commonly expressed in prokaryotic systems, specifically E. coli . The construct typically includes:

  • Full-length mature protein (amino acids 29-472)

  • N-terminal His-tag for purification purposes

  • Protein accession number: Q0P4Y4

Alternative expression systems used for related CGRP receptors in research settings include:

  • Mammalian expression systems: COS-7 or HeLa cells are often used for functional studies of receptor complexes, as demonstrated with mouse CRLR and RAMP1

  • Xenopus oocyte expression: While not specifically mentioned for tropicalis Calcrl in the sources, this system is commonly used for electrophysiological studies of membrane receptors

The E. coli expression system provides advantages for structural studies and biochemical assays, whereas mammalian systems are preferred when studying receptor function, signal transduction, and protein-protein interactions in a more physiological context .

How does the Calcrl receptor function in Xenopus compared to mammalian systems?

The Calcitonin gene-related peptide (CGRP) receptor shows functional similarity between Xenopus and mammalian systems, but with notable species-specific characteristics:

Similarities:

  • In both systems, the functional CGRP receptor requires interaction between Calcrl (CRLR) and RAMP1

  • Both act as G protein-coupled receptors that activate downstream signaling pathways

  • The receptor mediates physiological responses to CGRP peptides in both species

Differences and Xenopus-specific features:

  • In Xenopus laevis lateral line organ, CGRP receptor activation leads to dose-dependent increases in afferent nerve fiber discharge rates with EC50 values of approximately 1 μM

  • The response magnitude varies by CGRP isoform in Xenopus: r alpha-CGRP (31.2% increase), r beta-CGRP (18.9% increase), and h(Tyro) alpha-CGRP (10.3% increase)

  • In Xenopus, CGRP receptor-mediated responses show developmental regulation, appearing only after metamorphosis

  • The response develops progressively: first detectable at postmetamorphic day 6 (at a fraction of maximal response) and reaches maximum by postmetamorphic day 28

Pharmacological profile:

  • The receptor in Xenopus laevis exhibits pharmacology consistent with CGRP1 receptor subtype:

    • rCGRP8-37 (a selective CGRP1 receptor antagonist) competitively inhibits responses to r alpha-CGRP

    • r[Cys(ACM)2,7]alpha-CGRP (a CGRP2 agonist) has no effect on discharge rate

    • Related peptides like rat amylin and rat adrenomedullin have minimal or no effect

This comparative information helps researchers interpret findings across species and assess the validity of Xenopus as a model for studying CGRP receptor signaling.

What are the advantages of using Xenopus tropicalis as a model for Calcrl studies compared to Xenopus laevis?

Xenopus tropicalis offers several significant advantages over Xenopus laevis for genetic and functional studies of Calcrl:

Genomic advantages:

  • Diploid genome: X. tropicalis possesses a diploid genome, unlike the allotetraploid genome of X. laevis

  • Gene targeting efficiency: Knockdown or knockout of genes is more straightforward in X. tropicalis, with only two copies of each gene compared to four in X. laevis

  • Genome simplicity: "If you want to knock down multiple gene products, it's a much simpler exercise to knock them down in tropicalis, with only two copies of each gene, as opposed to knocking down or targeting gene products in laevis, where the problem is twice as complex"

Practical research advantages:

  • Shorter generation time: X. tropicalis has a significantly shorter lifecycle of approximately 4 months compared to a year or more for X. laevis

  • Space efficiency: X. tropicalis frogs require less housing space than X. laevis

  • Developmental consistency: X. tropicalis embryos develop at similar rates to X. laevis, allowing researchers to use the same developmental staging system (Nieuwkoop and Faber)

  • Methodological continuity: Many tools and techniques developed for X. laevis can be directly applied to X. tropicalis

  • Genomic resources: The sequenced genome of X. tropicalis enables comprehensive gene expression analysis: "Now that we have a complete catalog of genes, we can also design a gene chip to look at the changes in gene expression across the whole genome"

These advantages make X. tropicalis particularly valuable for researchers seeking to conduct genetic manipulation studies of Calcrl while maintaining the experimental advantages of the Xenopus model system.

What methods are recommended for studying Calcrl expression patterns during Xenopus development?

Several complementary approaches can be used to effectively study Calcrl expression patterns during Xenopus development:

1. RNA analysis techniques:

  • RT-PCR/qPCR: Using sequence information from the full-length Calcrl cDNA (Q0P4Y4) , design primers targeting specific regions of the transcript to quantify expression levels across developmental stages.

  • RNA-seq: Leverage the available X. tropicalis genome sequence to analyze transcriptome-wide expression patterns, including Calcrl, during development.

  • Whole-mount in situ hybridization (WISH): Use antisense RNA probes designed from the verified full ORF sequences available from X. tropicalis cDNA clones to visualize spatial expression patterns in intact embryos.

2. Protein detection methods:

  • Immunohistochemistry/Immunofluorescence: Using antibodies against Calcrl to visualize protein expression in tissue sections or whole embryos.

  • Western blot analysis: For quantitative assessment of protein levels across developmental stages.

3. Functional assays:

  • Developmental time course of CGRP responsiveness: Following the approach used in X. laevis, measure responses to CGRP at different developmental stages to determine when functional receptor expression occurs . The X. laevis study found that CGRP responses developed progressively after metamorphosis, starting at postmetamorphic day 6 and reaching maximum by day 28 .

4. Genetic manipulation:

  • Knockdown studies: Use morpholinos or CRISPR-Cas9 to reduce Calcrl expression and analyze resulting phenotypes at different developmental stages.

  • Reporter gene constructs: Create transgenic lines expressing fluorescent reporters under the Calcrl promoter to visualize expression dynamics in real-time.

5. Resources and standardization:

  • Utilize the developmental staging system of Nieuwkoop and Faber for consistent stage identification .

  • Reference the verified full-length cDNA clones available for X. tropicalis (part of the 2,918 clones reported) .

  • Design experiments to specifically examine post-metamorphic stages, when CGRP receptor function appears to develop based on X. laevis studies .

These methodologies provide complementary approaches to developing a comprehensive understanding of Calcrl expression and function throughout Xenopus development.

How can researchers effectively design ligand binding studies for Xenopus tropicalis Calcrl?

Designing effective ligand binding studies for Xenopus tropicalis Calcrl requires careful consideration of receptor complex formation, expression systems, and detection methods:

Receptor complex reconstitution:

  • Co-expression requirement: Similar to mouse CGRP receptor, functional binding of CGRP likely requires co-expression of both Calcrl and RAMP1 . Specific binding of 125I-CGRP in mouse studies was only detected when both mCRLR and mRAMP1 cDNAs were co-transfected into cells .

  • Heterologous expression systems:

    • Use mammalian cell lines (COS-7, HeLa, or HEK293) for co-transfection of Xenopus tropicalis Calcrl and RAMP1

    • Consider Xenopus oocyte expression for electrophysiological studies

Binding assay protocols:

  • Radioligand binding:

    • Use 125I-labeled CGRP as demonstrated in mouse studies (Kd value for mouse CGRP receptor: 2.2 × 10-10 M)

    • Include competitive binding studies with unlabeled peptides

    • Test selective antagonists like CGRP8-37 to confirm receptor subtype

  • Fluorescence-based methods:

    • Fluorescently labeled CGRP peptides

    • FRET or BRET-based assays to detect receptor-ligand interactions

Pharmacological characterization:

  • Multiple CGRP isoforms: Test different CGRP isoforms (α-CGRP, β-CGRP) and related peptides based on the X. laevis lateral line organ study, which found differential responses:

    • r alpha-CGRP: 31.2% increase in discharge rate

    • r beta-CGRP: 18.9% increase

    • h(Tyro) alpha-CGRP: 10.3% increase

  • Selectivity testing: Include other CGRP family peptides (amylin, adrenomedullin) and CGRP2 agonists like r[Cys(ACM)2,7]alpha-CGRP to confirm receptor selectivity

  • Determine EC50 values: In X. laevis, EC50 values for CGRP peptides were approximately 1 μM

Downstream response measurement:

  • cAMP accumulation assays: Mouse studies showed marked elevation of intracellular cAMP levels in response to CGRP

  • Promoter activity assays: Measure activities of cyclic AMP responsive element and serum responsive element

  • Afferent discharge measurements: For studies in sensory systems like the lateral line, measure discharge rates as in X. laevis studies

This comprehensive approach will help researchers accurately characterize ligand binding properties and subsequent signal transduction of Xenopus tropicalis Calcrl.

What strategies can be used to investigate structure-function relationships of Xenopus tropicalis Calcrl?

Investigating structure-function relationships of Xenopus tropicalis Calcrl requires multidisciplinary approaches combining molecular, biochemical, and computational techniques:

1. Mutagenesis approaches:

  • Site-directed mutagenesis: Target conserved residues in the:

    • Ligand binding domain

    • G-protein coupling sites

    • RAMP1 interaction interface

  • Domain swapping: Exchange domains between:

    • X. tropicalis and X. laevis Calcrl

    • Calcrl and related GPCRs

    • Different species' Calcrl orthologs

  • Truncation mutants: Generate N- or C-terminal truncations to identify essential regions for function

2. Functional characterization of mutants:

  • Ligand binding assays: Compare binding parameters (Kd, Bmax) between wild-type and mutant receptors

  • Signaling assays: Measure:

    • cAMP accumulation

    • ERK pathway activation

    • CRE and SRE promoter activities

  • Co-immunoprecipitation: Assess RAMP1 interaction with mutant receptors

  • Membrane trafficking studies: Evaluate surface expression using biotinylation or fluorescence-based techniques

3. Structural biology approaches:

  • Homology modeling: Create models based on crystal structures of related GPCRs

  • Computational docking: Predict CGRP binding modes and interaction sites

  • Molecular dynamics simulations: Investigate conformational changes upon ligand binding

4. Comparative analysis:

  • Sequence alignment: Compare Calcrl sequences across species to identify conserved and divergent regions

  • Evolutionary analysis: Examine selection pressures on different domains

  • Functional correlation: Link sequence conservation to functional importance

5. In vivo validation:

  • CRISPR-Cas9 gene editing: Generate X. tropicalis lines with specific Calcrl mutations

  • Phenotypic analysis: Assess developmental and physiological consequences of mutations

  • Rescue experiments: Test if wild-type human or mouse Calcrl can rescue phenotypes

Data from sequence analysis:

The full-length Xenopus tropicalis Calcrl protein sequence (amino acids 29-472) can be compared with the mouse CRLR (462 amino acids) to identify conserved functional domains. Key regions to target include:

  • N-terminal extracellular domain: Critical for ligand binding

  • Seven transmembrane domains: Important for structural integrity and conformational changes

  • Intracellular loops: Involved in G-protein coupling

  • C-terminal tail: Often involved in regulatory functions and protein-protein interactions

These comprehensive strategies will provide valuable insights into the molecular determinants of Calcrl function, potentially revealing therapeutic targets and evolutionary adaptations of this important receptor system.

How can the Xenopus tropicalis genome resources be leveraged to advance Calcrl research?

The sequenced genome of Xenopus tropicalis provides powerful resources for advancing Calcrl research through multiple approaches:

1. Genomic analysis and gene regulation:

  • Promoter analysis: The X. tropicalis genome sequence allows identification and characterization of the Calcrl promoter region to study transcriptional regulation

  • Enhancer mapping: Identify distal regulatory elements that control tissue-specific or developmental expression of Calcrl

  • Epigenetic profiling: Analyze chromatin modifications and accessibility at the Calcrl locus across developmental stages

  • Comparative genomics: Compare the genomic organization of Calcrl between X. tropicalis (diploid) and X. laevis (allotetraploid) to understand evolutionary conservation and divergence

2. Genetic manipulation strategies:

  • CRISPR-Cas9 gene editing: The diploid genome of X. tropicalis facilitates precise genetic manipulation of Calcrl

    • Generate knockout lines to study loss-of-function phenotypes

    • Create knock-in models with fluorescent tags or specific mutations

  • Morpholino-based approaches: Design specific morpholinos targeting Calcrl splice junctions or translation start sites

  • Transgenic reporter lines: Generate lines expressing fluorescent proteins under the control of the Calcrl promoter to visualize expression patterns

3. Transcriptomic applications:

  • Gene expression profiling: "Design a gene chip to look at the changes in gene expression across the whole genome" including Calcrl

  • RNA-seq analysis: Compare Calcrl expression across tissues and developmental stages

  • Single-cell transcriptomics: Identify cell populations expressing Calcrl at high resolution

  • Co-expression networks: Identify genes co-regulated with Calcrl to discover functional relationships

4. Utilizing existing resources:

  • cDNA clones: Access the verified full-length X. tropicalis cDNA clones (part of the 2,918 reported clones) for expression studies

  • Developmental tools: Apply the developmental staging system of Nieuwkoop and Faber for consistent experimental design

5. Comparative advantages over X. laevis:

  • Simpler genetic background: "If you want to knock down multiple gene products, it's a much simpler exercise to knock them down in tropicalis, with only two copies of each gene, as opposed to knocking down or targeting gene products in laevis, where the problem is twice as complex"

  • Faster generation time: ~4 months versus >1 year for X. laevis, accelerating genetic studies

  • Smaller size: Requires less space and resources for maintaining colonies

These genomic resources and advantages make X. tropicalis an excellent model system for comprehensive studies of Calcrl biology, from basic molecular characterization to complex physiological functions.

How do findings from Xenopus tropicalis Calcrl studies translate to understanding human CGRP receptor function?

Research on Xenopus tropicalis Calcrl provides valuable insights into human CGRP receptor function, but researchers should consider several factors when translating findings across species:

Evolutionary conservation and divergence:

  • Receptor complex components: Both Xenopus and human CGRP receptors require the interaction of Calcrl/CRLR with RAMP1 to form functional complexes

  • Signaling pathways: Core signaling mechanisms are conserved, including cAMP elevation and activation of PKA and ERK pathways

  • Pharmacological profiles: Xenopus CGRP receptors respond to alpha and beta CGRP isoforms and are antagonized by CGRP8-37, similar to human receptors

Experimental translation considerations:

  • Sequence homology assessment:

    • Compare amino acid sequences of X. tropicalis Calcrl (Q0P4Y4) with human CALCRL

    • Identify conserved domains critical for function versus divergent regions

    • Focus translational studies on highly conserved regions

  • Functional conservation testing:

    • Cross-species ligand testing: Determine if human CGRP peptides activate Xenopus receptors and vice versa

    • Compare pharmacological profiles using standardized assays

    • Evaluate responses to clinical CGRP receptor antagonists

  • Developmental context:

    • Consider the developmental regulation of CGRP receptor function observed in Xenopus, where responses develop progressively after metamorphosis

    • Investigate if similar developmental regulation exists in human systems

  • Tissue-specific functions:

    • The lateral line organ study in X. laevis revealed CGRP's role in modulating afferent nerve fiber discharge

    • Investigate parallel sensory system functions in humans, particularly in inner ear hair cells (evolutionary relatives of lateral line hair cells)

Advantages of Xenopus as a translational model:

  • The diploid genome of X. tropicalis facilitates genetic studies relevant to human disease models

  • The ability to generate large numbers of embryos permits high-throughput screening of CGRP receptor modulators

  • The accessibility of Xenopus embryos for manipulation allows detailed study of CGRP receptor biology during development

Limitations to consider:

  • Species-specific differences in receptor pharmacology may exist

  • The aquatic environment of Xenopus may influence CGRP system biology differently than in terrestrial mammals

  • Differences in body temperature (Xenopus being poikilothermic) may affect receptor kinetics and drug responses

By carefully considering these factors, researchers can maximize the translational value of findings from Xenopus tropicalis Calcrl studies to human CGRP receptor biology and related clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.