Recombinant Xenopus tropicalis Calcium-binding mitochondrial carrier protein SCaMC-1 (slc25a24)

Shipped with Ice Packs
In Stock

Description

Biological Significance and Mechanism

SCaMC-1, encoded by the slc25a24 gene, is a calcium-regulated mitochondrial carrier that exchanges ATP-Mg²⁺/ADP for phosphate ions . Its roles include:

  • Mitochondrial Calcium Buffering: SCaMC-1 imports ATP/ADP into mitochondria during cytosolic Ca²⁺ surges, enhancing matrix Ca²⁺ buffering capacity and desensitizing cells to mitochondrial permeability transition (mPT)-induced necrosis .

  • Cancer Cell Survival: Overexpression of SCaMC-1 in cancer cells promotes resistance to oxidative stress and Ca²⁺ overload by inhibiting mPT pore formation, a key pathway in stress-induced cell death . Knockdown sensitizes cells to necrosis, suggesting therapeutic targeting potential .

Key Research Findings:

  • In osteosarcoma cells, SCaMC-1 silencing reduced mitochondrial Ca²⁺ retention capacity by 60%, increasing susceptibility to H₂O₂-induced necrosis .

  • SCaMC-1 overexpression in colorectal cancer correlates with tumor microenvironment modulation via CCL5-mediated fibroblast recruitment .

Research Applications

This recombinant protein is utilized in:

  • Mitochondrial Transport Studies: Investigating ATP/ADP-Pi exchange mechanisms under varying Ca²⁺ conditions .

  • Cancer Biology: Exploring SCaMC-1’s role in tumor survival pathways and chemotherapy resistance .

  • Structural Analysis: Mapping Ca²⁺-binding domains and transport kinetics .

Comparative Functional Insights

FeatureSCaMC-1 (SLC25A24)Other APC Subtypes
Calcium SensitivityEF-hand motifs enable Ca²⁺-dependent activity APC2/3 (SLC25A23/25) share similar regulation
Tissue ExpressionBroadly expressed, upregulated in cancers APC3 (SLC25A25) shows tissue-specific roles
Pathological RolePro-survival in cancers APC4 (SLC25A41) linked to metabolic disorders

Limitations and Future Directions

While SCaMC-1’s role in cancer is established, conflicting data exist—e.g., its proposed tumor-suppressive function in colorectal cancer via fibroblast recruitment . Further studies using this recombinant protein could clarify context-dependent roles and therapeutic targeting strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
slc25a24; scamc1; Calcium-binding mitochondrial carrier protein SCaMC-1; Small calcium-binding mitochondrial carrier protein 1; Solute carrier family 25 member 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-473
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
slc25a24
Target Protein Sequence
MLEQVQKFLLSRAACEGPDPHTRYAELFHKLDVNKDGKVDIVELQEGLKAMGMAVGKGAE EKIVAAGDTNKDGHLDFGEFIRYLEEHEKKMKIAFTSLDKNKDGKIESAEIMNSLKTLGI NISLEHAEKILKSMDADGTLTVDWNEWRDHFLFNPADNIQQIIRYWKHSTVLDIGDSLTI PDEFTEEEKKTGQWWKQLLAGGMAGAVSRTGTAPLDRLKVMMQVHGSKGNANIITGLKQM VKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAERFIAGSLAGAT AQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGID LAIYETLKTFWLQNYATDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEG APQLNMGGLFRKIVAKEGFFGLYRGIAPNFLKVLPAVSISYVVYEKMKIKLGI
Uniprot No.

Target Background

Function
Recombinant Xenopus tropicalis Calcium-binding mitochondrial carrier protein SCaMC-1 (slc25a24) is a calcium-dependent mitochondrial solute carrier. It mediates the reversible, electroneutral exchange of Mg-ATP or Mg-ADP for phosphate ions, catalyzing the net uptake or efflux of adenine nucleotides across the mitochondrial inner membrane. Nucleotide transport is inactive at low cytosolic calcium levels but is activated by increased cytosolic calcium. This protein may play a protective role against oxidative stress-induced cell death, possibly by facilitating calcium-phosphate precipitate formation in the mitochondrial matrix, thus buffering mitochondrial matrix calcium levels.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SCaMC-1 (slc25a24) and what is its primary function in Xenopus tropicalis?

SCaMC-1 (slc25a24) is a calcium-binding mitochondrial carrier protein that mediates ATP-Mg²⁻/Pi²⁻ and/or HADP²⁻/Pi²⁻ uptake into mitochondria following increases in cytosolic calcium concentration. In Xenopus tropicalis, as in other species, this protein contributes significantly to calcium buffering within the mitochondrial matrix, resulting in desensitization of the mitochondrial permeability transition (mPT) . The full-length protein in Xenopus tropicalis consists of 473 amino acids and contains calcium-binding EF-hand domains in its N-terminal region that regulate transport activity .

What are the optimal conditions for expressing recombinant Xenopus tropicalis SCaMC-1 in E. coli systems?

For optimal expression of recombinant Xenopus tropicalis SCaMC-1 in E. coli, researchers should use the following protocol:

  • Vector Selection: Use a vector containing an N-terminal His-tag for subsequent purification.

  • E. coli Strain: BL21(DE3) or similar expression strains are recommended.

  • Induction Conditions: Induce with 0.5-1.0 mM IPTG when culture reaches OD600 of 0.6-0.8.

  • Post-Induction Incubation: 16-18 hours at 18-20°C to maximize soluble protein expression.

  • Lysis Buffer Composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF, and appropriate protease inhibitors.

This protocol typically yields 3-5 mg of purified protein per liter of bacterial culture .

What purification strategies provide the highest yield and purity of recombinant Xenopus tropicalis SCaMC-1?

A multi-step purification strategy is recommended to achieve >90% purity:

  • Initial Capture: Nickel affinity chromatography using Ni-NTA resin equilibrated with 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole.

  • Washing: Multiple washing steps with increasing imidazole concentrations (20 mM, 40 mM).

  • Elution: 250-300 mM imidazole in the same buffer.

  • Polishing Step: Size exclusion chromatography using Superdex 200 column in 50 mM Tris-HCl pH 8.0, 150 mM NaCl.

  • Concentration: Using 30 kDa cutoff concentrators to reach 1-5 mg/mL.

  • Quality Control: SDS-PAGE analysis confirms purity >90%.

The resulting protein should be aliquoted and stored at -80°C in Tris/PBS-based buffer with 50% glycerol to prevent freeze-thaw damage .

How can researchers effectively evaluate SCaMC-1 function in mitochondrial calcium handling experiments?

To evaluate SCaMC-1 function in mitochondrial calcium handling, implement this multi-parameter analytical approach:

  • Isolation of Mitochondria:

    • Isolate mitochondria from Xenopus tropicalis tissues or from cells expressing recombinant SCaMC-1

    • Maintain mitochondrial integrity using 225 mM mannitol, 75 mM sucrose, 1 mM EGTA, pH 7.4

  • Calcium Uptake Assays:

    • Use calcium-sensitive fluorescent probes (Calcium Green-5N or Rhod-2)

    • Monitor extramitochondrial and matrix Ca²⁺ levels simultaneously

    • Add defined Ca²⁺ pulses (10-100 μM) and measure uptake kinetics

  • ATP Transport Measurements:

    • Use ³²P-labeled ATP to track transport rates

    • Measure ATP-Mg/Pi exchange in the presence and absence of Ca²⁺

    • Quantify uptake using scintillation counting

  • Membrane Potential Assessment:

    • Monitor mitochondrial membrane potential using TMRM or JC-1 dyes

    • Correlate potential changes with Ca²⁺ uptake and ATP transport

  • mPT Induction Protocol:

    • Test mitochondrial permeability transition (mPT) sensitivity using Ca²⁺ challenge

    • Measure swelling spectrophotometrically at 540 nm

    • Compare mPT threshold between SCaMC-1-expressing and control mitochondria

What approaches can be used to study the protective role of SCaMC-1 against oxidative stress-induced cell death?

To investigate SCaMC-1's protective role against oxidative stress-induced cell death, researchers should implement the following experimental design:

  • Cell Model Development:

    • Generate SCaMC-1 knockdown and overexpression systems in relevant cell lines

    • Validate expression levels via Western blotting and qPCR

    • Create rescue lines expressing SCaMC-1 with synonymous mutations resistant to siRNA

  • Oxidative Stress Induction Protocol:

    • Apply H₂O₂ (100-500 μM) or menadione (5-50 μM) for defined periods

    • Create dose-response and time-course profiles

  • Cell Death Quantification:

    • Measure necrosis using propidium iodide exclusion assay

    • Assess apoptosis via Annexin V staining

    • Perform LDH release assays to quantify membrane integrity loss

  • Mitochondrial Function Assessment:

    • Monitor mitochondrial membrane potential changes using TMRM

    • Measure mitochondrial calcium using Rhod-2 AM

    • Assess mitochondrial permeability transition using calcein-AM/CoCl₂ technique

  • Inhibitor Studies:

    • Apply cyclosporin A (1 μM) and bongkrekic acid (50 μM) as mPT inhibitors

    • Compare protection between control and SCaMC-1-modified cells

This comprehensive approach revealed that SCaMC-1 knockdown rendered cells more susceptible to oxidative stress-induced death (H₂O₂ treatment), but had no effect on apoptosis induced by staurosporine, indicating that high expression levels of SCaMC-1 confer resistance specifically to mPT-dependent cell death .

What are the advantages of using Xenopus tropicalis as a model for studying SCaMC-1 compared to other experimental organisms?

Xenopus tropicalis offers several distinct advantages for SCaMC-1 research compared to other model organisms:

  • Genomic Simplicity: X. tropicalis possesses a diploid genome compared to the allotetraploid genome of X. laevis, facilitating genetic analysis and manipulation of specific genes like slc25a24 .

  • Developmental Accessibility: The embryonic development is external and easily manipulated, allowing for:

    • Direct observation of SCaMC-1 expression patterns during development

    • Microinjection of morpholinos for gene knockdown studies

    • Functional analysis in specific tissues using targeted mRNA injection

  • Evolutionary Position: As an amphibian, X. tropicalis represents an important evolutionary position between fish and mammals, providing insights into conserved functions of SCaMC-1.

  • Technical Advantages:

    • Shorter generation time (4-6 months) compared to X. laevis (1-2 years)

    • Smaller genome size (1.7 × 10⁹ bp compared to 3.1 × 10⁹ bp in X. laevis)

    • Compatibility with established X. laevis experimental protocols

    • Available whole-genome sequence data

  • Resource Availability: Comprehensive genetic tools including:

    • Simple sequence length polymorphisms (SSLPs) for genetic mapping

    • Established gynogenetic screening methods

    • Transgenesis protocols using I-SceI meganuclease method

How does the structure and function of SCaMC-1 in Xenopus tropicalis compare to its mammalian counterparts?

A comparative analysis of SCaMC-1 across species reveals important structural and functional conservation patterns:

FeatureXenopus tropicalis SCaMC-1Human SCaMC-1Mouse SCaMC-1
Protein Length473 amino acids477 amino acids477 amino acids
N-terminal DomainContains 4 EF-hand motifsContains 4 EF-hand motifsContains 4 EF-hand motifs
C-terminal Domain6 transmembrane segments6 transmembrane segments6 transmembrane segments
Ca²⁺-binding AffinityModerate (μM range)High (sub-μM range)High (sub-μM range)
ATP TransportATP-Mg²⁻/Pi²⁻ exchangeATP-Mg²⁻/Pi²⁻ exchangeATP-Mg²⁻/Pi²⁻ exchange
Ca²⁺ RegulationRequires Ca²⁺ for activationRequires Ca²⁺ for activationRequires Ca²⁺ for activation
Tissue ExpressionWidespreadWidespread, high in cancer cellsWidespread
Mitochondrial ImportCompleteCompleteComplete

Key functional differences include:

  • Mammalian SCaMC-1 shows higher calcium sensitivity than Xenopus tropicalis SCaMC-1

  • Human SCaMC-1 demonstrates increased expression in cancer and transformed cells

  • The regulatory N-terminal domain shows greater sequence divergence across species compared to the more conserved carrier domain

  • Xenopus tropicalis SCaMC-1 exhibits slightly different kinetic parameters for ATP/ADP transport

How can researchers design knockdown experiments to study SCaMC-1 function in Xenopus tropicalis?

To effectively study SCaMC-1 function through knockdown approaches in Xenopus tropicalis, implement this comprehensive protocol:

  • Morpholino Design Strategy:

    • Target translation start site (5'-GCATCTTCACAGAAGCCATTGTTGA-3')

    • Design splice-blocking morpholinos targeting exon-intron junctions

    • Include 5-base mismatch control morpholinos

    • Validate specificity using BLAST against Xenopus tropicalis genome

  • Microinjection Protocol:

    • Inject 2-10 ng morpholino at 1-2 cell stage

    • Co-inject lineage tracer (e.g., fluorescein dextran)

    • For tissue-specific studies, inject at 8-16 cell stage into specific blastomeres

  • Validation of Knockdown:

    • Western blot using anti-SCaMC-1 antibodies

    • RT-PCR to verify splicing alterations for splice-blocking morpholinos

    • Immunohistochemistry to assess tissue-specific knockdown

  • Rescue Experiments:

    • Co-inject morpholino-resistant slc25a24 mRNA

    • Use mRNA with silent mutations in the morpholino target site

    • Include appropriate controls (uninjected, control morpholino, mRNA only)

  • Phenotypic Analysis:

    • Mitochondrial function assessment (membrane potential, calcium handling)

    • Cell death assays following oxidative stress

    • Tissue-specific phenotypes assessment through histological analysis

    • Metabolic analysis (ATP levels, oxygen consumption rate)

This approach provides rigorous validation of knockdown specificity and enables comprehensive functional analysis of SCaMC-1 in development and stress response .

What methodological approaches can be used to study the interaction between SCaMC-1 and the mitochondrial permeability transition pore complex?

To investigate interactions between SCaMC-1 and the mitochondrial permeability transition pore (mPTP) complex, researchers should employ the following multi-technique approach:

  • Biochemical Interaction Studies:

    • Co-immunoprecipitation using anti-SCaMC-1 antibodies followed by mass spectrometry

    • Proximity labeling with BioID or APEX2 fused to SCaMC-1

    • Crosslinking mass spectrometry to identify molecular interfaces

    • Blue native PAGE to preserve protein complexes followed by Western blotting

  • Real-time Imaging Approaches:

    • FRET/BRET between SCaMC-1-CFP and mPTP components tagged with YFP

    • Split-GFP complementation assays

    • Live-cell confocal microscopy with fluorescently tagged proteins

    • Super-resolution microscopy (STORM/PALM) for nanoscale localization

  • Functional Assessment:

    • CsA-sensitive mitochondrial swelling assays with varied Ca²⁺ concentrations

    • Patch-clamp of mitochondrial membranes to measure channel conductance

    • Measurement of mitochondrial Ca²⁺ retention capacity in SCaMC-1-depleted mitochondria

    • Calcein-cobalt quenching assay to assess mPTP opening dynamics

  • Mutagenesis Studies:

    • Generate SCaMC-1 Ca²⁺-binding site mutants (EF-hand domains)

    • Create transmembrane domain mutants affecting ATP transport

    • Develop chimeric proteins with domains from related carriers

    • Express truncated forms lacking regulatory domains

Research using these methods has revealed that SCaMC-1 operates as a negative feedback regulator between cellular Ca²⁺ overload and mPT-dependent cell death. Its activity increases mitochondrial ATP which enhances matrix Ca²⁺ buffering capacity, thereby raising the threshold for mPTP opening during oxidative stress .

How does SCaMC-1 expression and function contribute to cancer cell survival?

SCaMC-1 plays a crucial role in cancer cell survival through multiple mechanisms:

  • Expression Pattern Analysis:
    Comprehensive gene expression analysis has demonstrated that SCaMC-1 overexpression is a general feature of transformed and cancer cells across multiple tumor types. This suggests a selective advantage conferred by increased SCaMC-1 expression during oncogenic transformation .

  • Mitochondrial Calcium Buffering:
    Cancer cells with elevated SCaMC-1 expression demonstrate enhanced mitochondrial calcium buffering capacity through increased ATP-Mg/Pi transport. This enhanced buffering provides protection against calcium overload by:

    • Increasing matrix ATP levels by 30-50%

    • Enhancing calcium-phosphate precipitation within the matrix

    • Raising the threshold for mitochondrial permeability transition

  • Cell Death Resistance Mechanisms:
    SCaMC-1 specifically protects against mPT-mediated necrotic cell death:

    • Knockdown of SCaMC-1 rendered cancer cells more susceptible to oxidative stress (H₂O₂, menadione)

    • SCaMC-1 depletion led to mitochondrial depolarization at lower calcium concentrations

    • Addition of cyclosporin-A and bongkrekic acid prevented mitochondrial depolarization in SCaMC-1-depleted cells

  • Experimental Evidence:
    In reconstitution experiments, re-expression of SCaMC-1 in knockdown cells restored resistance to H₂O₂ and C₂-ceramide-induced cell death. Additionally, overexpression of SCaMC-1 in cells with low endogenous expression conferred protection against oxidative stress-induced death, confirming its direct role in cytoprotection .

What is the relationship between SLC25A24 gene methylation and disease states?

Research has revealed complex relationships between SLC25A24 gene methylation and various disease states:

  • Epigenetic Regulation Pattern:
    SLC25A24 gene methylation shows distinct patterns in different contexts:

    • Methylation occurs primarily in CpG islands within the SLC25A24 gene promoter

    • Differential methylation has been observed between normal and pathological tissue samples

    • Female-specific methylation patterns have been identified in certain disorders

  • Neuropsychiatric Correlation:
    Studies have demonstrated an inverse pattern of correlation between callous-unemotional (CU) traits and methylation of a chromosome 1 region containing SLC25A24:

    • Positive correlation in females with conduct disorder

    • Negative correlation in typically developing females

    • These patterns correlate with gray matter volume variations in multiple brain regions

  • Brain Structure Associations:
    Increased SLC25A24 methylation correlates with lower gray matter volume in multiple brain regions including:

    • Superior frontal gyrus

    • Dorsolateral prefrontal cortex

    • Supramarginal gyrus

    • Secondary visual cortex

    • Ventral posterior cingulate cortex

  • Molecular Mechanisms:
    The relationship between methylation and disease appears linked to:

    • Altered mitochondrial energy metabolism due to changed SCaMC-1 expression

    • Disrupted calcium homeostasis affecting neuronal function

    • Potential impacts on cellular stress responses and resilience

These findings suggest that SLC25A24 methylation may serve as an epigenetic biomarker for certain disorders and highlight the importance of SCaMC-1 in maintaining cellular energy homeostasis in the context of disease .

What are the most effective methods for assessing SCaMC-1 transport activity in isolated mitochondria?

For precise assessment of SCaMC-1 transport activity in isolated mitochondria, researchers should employ the following optimized methods:

  • Radioisotope Transport Assay:

    • Prepare purified mitochondria from Xenopus tissues or expression systems

    • Incubate mitochondria with [³²P]ATP or [³⁵S]ATP in the presence of varying Ca²⁺ concentrations

    • Terminate reaction by rapid filtration through cellulose acetate filters

    • Quantify uptake by scintillation counting

    • Calculate transport kinetics (Km, Vmax) as a function of Ca²⁺ concentration

  • Fluorescent Nucleotide Transport Assay:

    • Use fluorescently labeled ATP analogs (e.g., TNP-ATP)

    • Monitor real-time uptake using fluorescence spectroscopy

    • Correlate transport with membrane potential changes

    • Assess Ca²⁺ sensitivity across physiological range (0.1-10 μM)

  • Reconstitution in Liposomes:

    • Purify recombinant SCaMC-1 protein to >95% homogeneity

    • Reconstitute in liposomes with defined phospholipid composition

    • Perform transport assays in a controlled lipid environment

    • Compare wild-type and mutant SCaMC-1 variants

  • Membrane Potential Consideration:

    • Monitor Δψ using voltage-sensitive dyes (e.g., TMRM, JC-1)

    • Control for membrane potential effects on transport

    • Use K⁺/valinomycin to set defined potentials

  • Data Analysis Parameters:

    • Initial rates determination (first 15-30 seconds)

    • Hill coefficient calculation for Ca²⁺ dependence

    • Inhibitor sensitivity (atractyloside, bongkrekic acid)

    • Temperature dependence for thermodynamic analysis

This methodological approach revealed that SCaMC-1 transport activity is strictly Ca²⁺-dependent, with a threshold for activation in the low micromolar range that correlates with cytosolic Ca²⁺ elevations during cellular stress .

How can researchers effectively analyze the impact of SCaMC-1 mutations on protein structure and function?

To comprehensively analyze SCaMC-1 mutations' impact on structure and function, researchers should implement this integrated workflow:

  • Structure-Based Mutation Design:

    • Target conserved residues identified through multiple sequence alignment

    • Focus on:

      • EF-hand Ca²⁺-binding motifs in N-terminal domain

      • Carrier signature motifs in transmembrane regions

      • Substrate-binding residues predicted by homology modeling

    • Generate single and combined mutations using site-directed mutagenesis

  • Expression and Localization Analysis:

    • Express wild-type and mutant constructs in appropriate cell systems

    • Assess mitochondrial targeting efficiency using:

      • Subcellular fractionation followed by Western blotting

      • Immunofluorescence microscopy with mitochondrial co-markers

      • Live-cell imaging with fluorescent protein fusions

  • Biophysical Characterization:

    • Analyze protein stability using thermal shift assays

    • Measure Ca²⁺-binding properties through:

      • Isothermal titration calorimetry (ITC)

      • Circular dichroism spectroscopy

      • Tryptophan fluorescence quenching

  • Functional Transport Assays:

    • Reconstitute purified proteins in liposomes

    • Measure ATP-Mg/Pi transport activity as a function of Ca²⁺ concentration

    • Determine kinetic parameters (Km, Vmax) for different substrates

    • Assess competitive inhibition profiles

  • Cellular Phenotype Assessment:

    • Express mutants in SCaMC-1-depleted cells

    • Challenge with oxidative stressors (H₂O₂, menadione)

    • Measure:

      • Mitochondrial Ca²⁺ uptake capacity

      • mPT sensitivity

      • Cell survival following stress

Studies using this approach revealed that the N-terminal hydrophilic domain of SCaMC-1 negatively affects its mitochondrial import, as truncated proteins lacking this domain showed higher mitochondrial localization. Additionally, mutations in calcium-binding EF-hand motifs abolished the protein's ability to protect against oxidative stress-induced mPT and cell death .

What are the most promising avenues for therapeutic targeting of SCaMC-1 in cancer treatment?

Based on current understanding of SCaMC-1's role in cancer cell survival, several promising therapeutic targeting strategies emerge:

  • Direct Inhibitor Development:

    • Small molecule inhibitors targeting the ATP-Mg/Pi transport function

    • Compounds disrupting Ca²⁺-dependent regulation through EF-hand domains

    • Allosteric modulators affecting conformational changes

    • Peptide inhibitors mimicking regulatory domains

  • Combination Therapy Approaches:

    • SCaMC-1 inhibition to sensitize cancer cells to:

      • Oxidative stress-inducing chemotherapeutics

      • Radiation therapy

      • Immunotherapy approaches that trigger calcium overload

      • Compounds that promote mPT (e.g., selective cyclophilin-D modulators)

  • Gene Expression Modulation:

    • siRNA/shRNA delivery systems for SCaMC-1 knockdown

    • CRISPR/Cas9-mediated disruption of SLC25A24 in tumors

    • Epigenetic modulators targeting SLC25A24 promoter methylation

    • Transcriptional repressors specific to the SLC25A24 locus

  • Diagnostic Strategies:

    • Develop SCaMC-1 expression profiling as a biomarker for:

      • Tumor aggressiveness

      • Treatment resistance prediction

      • Patient stratification for personalized medicine approaches

  • Delivery Systems Development:

    • Mitochondria-targeted nanoparticles for SCaMC-1 inhibitor delivery

    • Tumor-selective targeting strategies

    • Controlled release systems for sustained inhibition

Research indicates that SCaMC-1 represents a promising cancer therapy target due to its overexpression in transformed cells and its specific role in protecting against mPT-dependent cell death while having minimal impact on apoptotic pathways. This selective protective function suggests that inhibition might preferentially sensitize cancer cells to oxidative stress-induced death pathways while minimally affecting normal tissues .

What are the current limitations in SCaMC-1 research and how might they be addressed in future studies?

Current SCaMC-1 research faces several critical limitations that must be addressed to advance understanding of this important protein:

  • Structural Information Deficit:

    • Current limitation: Lack of high-resolution structures for SCaMC-1 from any species

    • Future approaches:

      • Cryo-EM studies of purified SCaMC-1 in nanodiscs

      • X-ray crystallography of stabilized protein complexes

      • Molecular dynamics simulations based on homology models

      • NMR studies of isolated domains

  • Physiological Regulation Gaps:

    • Current limitation: Incomplete understanding of SCaMC-1 regulation beyond Ca²⁺

    • Future approaches:

      • Proteomic identification of post-translational modifications

      • Investigation of metabolic regulation during different cellular states

      • Analysis of protein-protein interactions using proximity labeling

      • Integration with other mitochondrial calcium handling systems

  • Technical Challenges in Model Systems:

    • Current limitation: Difficulties in genetic manipulation of Xenopus tropicalis

    • Future approaches:

      • CRISPR/Cas9 gene editing optimization for X. tropicalis

      • Development of conditional knockout systems

      • Tissue-specific promoters for transgenic approaches

      • Single-cell transcriptomics to capture heterogeneity

  • Translation to Human Disease:

    • Current limitation: Insufficient data connecting SCaMC-1 function to human pathologies

    • Future approaches:

      • Patient-derived cell studies examining SCaMC-1 variants

      • Analysis of SCaMC-1 in clinical samples across disease states

      • Development of humanized animal models

      • Integration with genome-wide association studies

  • Methodological Limitations:

    • Current limitation: Challenges in measuring SCaMC-1 activity in intact cells

    • Future approaches:

      • Development of genetically encoded sensors for ATP transport

      • Label-free methods for assessing mitochondrial nucleotide content

      • Single-mitochondrion analysis techniques

      • Advanced imaging approaches for real-time activity monitoring

Addressing these limitations will require interdisciplinary approaches combining structural biology, genetics, cell physiology, and clinical research to fully elucidate the role of SCaMC-1 in normal physiology and disease states .

What quality control measures should be implemented when working with recombinant Xenopus tropicalis SCaMC-1?

To ensure experimental reliability with recombinant Xenopus tropicalis SCaMC-1, implement these comprehensive quality control measures:

  • Protein Identity Verification:

    • SDS-PAGE analysis to confirm molecular weight (approximately 50 kDa)

    • Western blot using anti-His tag and specific anti-SCaMC-1 antibodies

    • Mass spectrometry peptide fingerprinting

    • N-terminal sequencing of purified protein

  • Purity Assessment:

    • SDS-PAGE with densitometry analysis (target >90% purity)

    • Size exclusion chromatography profiles

    • Dynamic light scattering to detect aggregation

    • Endotoxin testing for proteins expressed in E. coli

  • Functional Validation:

    • Calcium-binding assay using isothermal titration calorimetry

    • ATP transport activity in reconstituted liposomes

    • Circular dichroism to confirm secondary structure integrity

    • Thermal stability assessment using differential scanning fluorimetry

  • Storage Stability Monitoring:

    • Aliquot in small volumes to prevent repeated freeze-thaw cycles

    • Store at -80°C in Tris/PBS-based buffer with 50% glycerol

    • Test activity retention after storage periods

    • Monitor for degradation products using Western blot

  • Batch-to-Batch Consistency:

    • Standardized expression and purification protocols

    • Reference standards for activity comparison

    • Detailed documentation including growth conditions and yields

    • Consistent verification of N-terminal His-tag integrity

The recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided .

How can researchers address the challenges in comparing SCaMC-1 function across different experimental models?

To effectively compare SCaMC-1 function across diverse experimental models, researchers should implement this standardized approach:

  • Expression Level Normalization:

    • Quantitative Western blotting with recombinant protein standards

    • qRT-PCR with validated reference genes for each species

    • Flow cytometry for cell-by-cell expression analysis

    • Absolute protein quantification using mass spectrometry

    SpeciesRecommended Reference GenesAntibody DilutionDetection Method
    X. tropicalisef1α, odc1, rpl81:500 anti-SCaMC-1Chemiluminescence
    HumanGAPDH, ACTB, B2M1:1000 anti-SCaMC-1Chemiluminescence
    MouseGapdh, Actb, Hprt1:1000 anti-SCaMC-1Chemiluminescence
  • Functional Assay Standardization:

    • Identical buffer compositions across experimental systems

    • Temperature normalization (considering physiological differences)

    • Common endpoint measurements and analytical techniques

    • Parallel positive and negative controls

  • Model-Specific Considerations:

    • Developmental stage matching for Xenopus studies

    • Cell cycle synchronization for cultured cell experiments

    • Tissue-specific expression patterns documentation

    • Consideration of species-specific metabolic rates

  • Data Integration Framework:

    • Consistent statistical analysis methodologies

    • Normalization to internal standards

    • Meta-analysis approaches for cross-study comparison

    • Mathematical modeling to account for biological variability

  • Technological Platform Consistency:

    • Use identical or cross-calibrated equipment

    • Implement blinded analysis where possible

    • Develop standard operating procedures across laboratories

    • Employ randomization strategies to minimize bias

This comprehensive approach accounts for the inherent biological differences between experimental models while maintaining scientific rigor and reproducibility in comparative studies of SCaMC-1 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.