Recombinant Xenopus tropicalis Calcium-binding mitochondrial carrier protein SCaMC-2 (slc25a25)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Metabolism

SCaMC-2 operates as a Ca²⁺-activated ATP-Mg²⁺/phosphate carrier, critical for maintaining mitochondrial ATP pools under fluctuating energy demands :

  • Substrate specificity: Transports ATP-Mg²⁺ into mitochondria in exchange for phosphate (Pi) .

  • Calcium regulation: Ca²⁺ binding to EF-hand motifs enhances transport activity by 3–5 fold .

  • Metabolic impact: Knockout studies in mice (Slc25a25⁻/⁻) show reduced mitochondrial respiration, ATP synthesis, and altered metabolite profiles (e.g., decreased succinate, increased UDP-glucose) .

3.1. Role in Developmental Biology

  • Left–right patterning: In zebrafish, slc25a25b knockdown disrupts Nodal signaling (e.g., southpaw expression), causing organ laterality defects .

  • Male fertility: Drosophila lacking SCaMC exhibit sterility due to impaired spermatogenesis, rescued by human SLC25A25 expression .

3.2. Metabolic Efficiency Studies

  • Obesity resistance: Slc25a25⁻/⁻ mice resist diet-induced obesity but exhibit impaired exercise capacity .

  • Cellular energy flux: Fibroblasts from knockout mice show reduced ER Ca²⁺ flux and basal respiration .

3.3. Disease Relevance

  • Cancer: SLC25A25 is implicated in tumor metabolism, with altered expression affecting mitochondrial NAD⁺/NADH ratios and nucleotide pools .

  • Neurological disorders: Dysregulated calcium-dependent transport may contribute to neurodegenerative conditions .

Comparative Analysis Across Species

SCaMC-2 orthologs share conserved functional domains but exhibit species-specific adaptations:

SpeciesGene NameKey Functional Differences
Xenopus tropicalisslc25a25Used for structural studies due to high solubility
Homo sapiensSLC25A25Four splice variants with varying N-terminal EF-hands
Danio rerioslc25a25a/bDuplicated genes regulating left–right asymmetry

Technical Considerations for Experimental Use

  • Reconstitution: Requires solubilization in deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term stability .

  • Activity assays: Thermostability assays confirm Ca²⁺-induced conformational changes (Tₘ shift from 49.5°C to 54°C) .

  • Metabolomic profiling: LC-MS reveals SLC25A25-dependent changes in TCA cycle intermediates and nucleotide sugars .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc25a25; scamc2; Calcium-binding mitochondrial carrier protein SCaMC-2; Small calcium-binding mitochondrial carrier protein 2; Solute carrier family 25 member 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-513
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
slc25a25
Target Protein Sequence
MARPRSLVSPLLSGVFCQCDTVGGAPHTHDTPASPSLAAALAADPCGGLVCGGPEHETRL QILFQELDVNKDGGICINDLAVGLKRLGVHRTELELRKIVKAGDKDQDGQLDFEEFVHYL RDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVNISEQQAEKILKSMDKNGTMTIDW NEWRDYHLLHPAENIPEIILYWKHSTIFDVGENLLVPDEFTVEEKQTGMWWRHLVAGGGA GAVSRTCTAPLDRLKVLMQVHASRSNNMSMLGGFTQMIREGGIRSLWRGNGINVIKIAPE SAIKFMAYEQMKRIIGSDQETLGIHERLVAGSLAGVIAQSSIYPMEVLKTRMALRKTGQY QGMLDCGKKILLKEGVSAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQRYATSSADPG VFVLLACGTISSTCGQLASYPLALVRTRMQAEASVEGAPQMTMSKLFKHIVKTEGAFGLY RGLAPNFMKVIPAVSISYVVYENLKLTLGVQSR
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is slc25a25 and what are its alternative gene designations in Xenopus tropicalis?

Slc25a25 encodes the Calcium-binding mitochondrial carrier protein SCaMC-2 in Xenopus tropicalis. This protein belongs to the solute carrier family 25, which consists of mitochondrial carrier proteins. Alternative gene names documented in the literature include mcsc, pcscl, scamc2, and scamc-2. The protein is formally classified as a calcium-binding mitochondrial carrier protein, specifically isoform 1, and functions as a mitochondrial phosphate carrier within the broader solute carrier family 25 framework .

How does Xenopus tropicalis slc25a25 compare structurally to orthologues in other species?

Xenopus tropicalis slc25a25 shares significant structural homology with orthologues from other species including human SLC25A25, mouse Slc25a25, and zebrafish slc25a25a. All maintain the characteristic calcium-binding domains and mitochondrial carrier motifs essential for function. The protein contains conserved EF-hand calcium-binding domains in the N-terminal region and six transmembrane domains typical of mitochondrial carrier proteins. While the transmembrane domains show high conservation across species (>80% similarity), the calcium-binding regulatory domains exhibit more evolutionary divergence, particularly between amphibian and mammalian orthologues .

What expression systems are most effective for producing recombinant Xenopus tropicalis slc25a25?

Multiple expression systems have been validated for the production of recombinant Xenopus tropicalis slc25a25, each with distinct advantages depending on experimental requirements. Common platforms include bacterial (E. coli), yeast, baculovirus, mammalian cell systems, and cell-free expression systems. For structural studies requiring high yield with minimal post-translational modifications, E. coli or cell-free systems are often preferred. Mammalian expression systems, while typically offering lower yields, provide more native-like post-translational modifications that may be critical for functional studies. All validated systems can achieve ≥85% purity as determined by SDS-PAGE when coupled with appropriate purification protocols .

What technical challenges are common when expressing full-length versus partial constructs of slc25a25?

Full-length slc25a25 expression often presents challenges due to the distinct biochemical properties of its domains. The calcium-binding N-terminal regulatory domain is highly soluble but the transmembrane carrier domain can cause aggregation and reduced expression efficiency. For functional studies requiring the complete protein, mammalian or baculovirus systems typically yield better results. Partial constructs containing only the N-terminal regulatory domain express with higher efficiency in bacterial systems, while constructs of the carrier domain often benefit from fusion tags to improve solubility. Expression of partial constructs (particularly the N-terminal domain) can achieve >95% purity compared to the typical 85% for full-length protein .

What are the recommended methods for validating the activity of recombinant Xenopus tropicalis slc25a25?

Validation of recombinant Xenopus tropicalis slc25a25 activity requires assessment of both calcium-binding capability and transport function. For calcium-binding evaluation, isothermal titration calorimetry (ITC) provides quantitative binding parameters, while calcium-dependent mobility shifts in native PAGE offer a simpler qualitative assessment. Transport function can be evaluated using reconstituted liposomes with entrapped fluorescent indicators for detecting substrate transport. Alternatively, complementation assays in yeast strains lacking endogenous mitochondrial carriers can demonstrate functionality in a cellular context. These approaches should be complemented with basic quality control including SDS-PAGE analysis (≥85% purity) and western blotting using validated antibodies against slc25a25 .

How can researchers optimize Western blot protocols for detecting Xenopus tropicalis slc25a25?

Optimizing Western blot protocols for Xenopus tropicalis slc25a25 requires careful consideration of several factors. Based on available antibodies, rabbit-derived polyclonal antibodies show good cross-reactivity with Xenopus tropicalis slc25a25. Transfer efficiency is optimized using PVDF membranes with 0.45 μm pore size for the full-length protein (approximately 50-55 kDa). A prolonged blocking step (2 hours at room temperature or overnight at 4°C) with 5% non-fat milk reduces background staining. Primary antibody concentrations between 1:500 and 1:1000 typically yield optimal signal-to-noise ratios. For researchers generating their own antibodies, the N-terminal domain (amino acids 1-190) typically contains more antigenic epitopes than the highly conserved transmembrane domains .

How does slc25a25 expression differ between Xenopus tropicalis and Xenopus laevis in response to developmental signals?

The table below summarizes the comparative expression response to activin treatment:

SpeciesMinimal Effective Activin DoseTime to Detectable ExpressionOptimal Culture TemperatureExpression Pattern
X. tropicalis0.5-1.0 ng/ml3-4 hours25°CStrong dose-dependence
X. laevis0.5 ng/ml4-5 hours20°CModerate dose-dependence

What spatial expression patterns does slc25a25 exhibit during Xenopus tropicalis embryonic development?

During Xenopus tropicalis embryonic development, slc25a25 exhibits dynamic spatial expression patterns that correlate with its proposed roles in energy metabolism and calcium signaling. During early cleavage stages, maternal transcripts are distributed uniformly throughout the embryo. By late blastula stage, expression becomes enriched in the animal hemisphere. During gastrulation, expression localizes predominantly to the developing mesoderm, particularly in dorsal regions including the organizer territory. By neurula stages, expression is prominent in the developing neural tissue, somites, and cardiac primordia. In tailbud and tadpole stages, strong expression persists in the central nervous system, developing muscles, and organs with high metabolic demands including the heart, kidneys, and liver. This pattern is consistent with tissues requiring robust calcium signaling and metabolic flexibility during development .

What methods are most effective for studying the physiological function of slc25a25 in Xenopus tropicalis models?

Multiple complementary approaches provide robust insights into slc25a25 function in Xenopus tropicalis. Morpholino-mediated knockdown represents an effective method for studying loss-of-function phenotypes during early development, with validation through rescue experiments using morpholino-resistant mRNA. CRISPR/Cas9-mediated genome editing enables generation of stable slc25a25 mutant lines for analyzing longer-term phenotypes. For biochemical characterization, mitochondria isolated from embryonic tissues can be analyzed for transport activity using radioisotope-labeled substrates. Combined with oxygen consumption measurements and calcium flux assays, these approaches provide comprehensive functional assessment. Animal cap assays utilizing activin induction protocols (10-100 ng/ml concentration range) are particularly valuable for studying slc25a25's role in mesodermal differentiation, allowing for controlled manipulation of signaling pathways in an isolated tissue context .

How does calcium signaling modulate slc25a25 function in mitochondrial metabolism?

Calcium signaling serves as a critical regulator of slc25a25 function in mitochondrial metabolism through multiple mechanisms. The N-terminal EF-hand domains of slc25a25 undergo conformational changes upon calcium binding, directly modulating transport activity. Under physiological conditions, calcium concentrations between 0.1-1.0 μM promote optimal transport activity, while concentrations exceeding 5 μM may lead to inhibition through alternative mechanisms. This calcium-dependent regulation allows slc25a25 to synchronize mitochondrial metabolite transport with cytosolic calcium signals generated during cellular activities with high energy demands. In Xenopus tropicalis models, tissue-specific calcium signaling profiles (particularly in neural and muscle tissues) correlate with slc25a25 expression patterns, suggesting co-evolution of calcium signaling networks and slc25a25 regulatory properties to meet tissue-specific metabolic requirements .

How can recombinant Xenopus tropicalis slc25a25 be utilized for structural biology studies?

Recombinant Xenopus tropicalis slc25a25 offers several advantages for structural biology studies. For X-ray crystallography, the protein expressed in E. coli or cell-free systems with appropriate solubility tags can be purified to homogeneity (>95%) using affinity chromatography followed by size exclusion chromatography. Limited proteolysis approaches have identified stable domains suitable for crystallization, particularly the N-terminal calcium-binding domain (residues 1-190). For cryo-electron microscopy (cryo-EM), full-length protein expressed in mammalian systems maintains more native conformation and can be reconstituted into nanodiscs or amphipols to preserve the membrane-embedded regions. NMR studies have been successful primarily with the soluble N-terminal domain, providing insights into calcium-induced conformational changes. Comparison of structures between calcium-bound and calcium-free states reveals significant conformational changes that propagate to the carrier domain, providing mechanistic insights into calcium-regulated transport function .

What experimental approaches can resolve contradictory data regarding slc25a25 substrate specificity?

Resolving contradictory data regarding slc25a25 substrate specificity requires multilevel experimental approaches. In vitro transport assays using purified protein reconstituted into liposomes provide direct evidence of transport capabilities but may not fully recapitulate the regulatory environment of intact mitochondria. Complementary approaches include:

  • Isotope-labeled substrate transport assays using mitochondria isolated from slc25a25 knockout/knockdown models compared with wild-type controls

  • Metabolomic profiling of cells/tissues with manipulated slc25a25 expression to identify accumulated or depleted metabolites

  • Competitive inhibition studies to determine relative affinities for different substrates

  • Molecular dynamics simulations based on structural data to predict substrate binding and translocation pathways

  • Site-directed mutagenesis of predicted substrate-binding residues followed by functional assays

This combinatorial approach can distinguish primary from secondary substrates and identify species-specific differences in substrate preference between Xenopus tropicalis slc25a25 and orthologues in other organisms .

What critical controls should be included when studying slc25a25 in Xenopus tropicalis animal cap assays?

When studying slc25a25 in Xenopus tropicalis animal cap assays, several critical controls are essential for rigorous experimental design. First, untreated animal caps serve as negative controls to establish baseline expression levels. Time-matched whole embryo samples provide positive controls for gene expression analysis. For activin induction experiments, a dose-response series (0, 0.5, 1, 10, 100 ng/ml) is necessary to establish threshold responses. Temperature controls are particularly critical, as Xenopus tropicalis develops optimally at 25°C while Xenopus laevis prefers 20°C. This temperature difference significantly impacts signaling dynamics and gene expression timing. For RT-PCR and qPCR analyses, multiple reference genes (e.g., ODC and EF-1α) should be used to normalize expression data. When manipulating slc25a25 expression, both gain-of-function (mRNA injection) and loss-of-function (morpholino or CRISPR) approaches should be employed with appropriate controls (e.g., control morpholino, rescue experiments) .

How should researchers account for species-specific differences when extrapolating slc25a25 function from Xenopus tropicalis to other model organisms?

When extrapolating slc25a25 function from Xenopus tropicalis to other model organisms, researchers must account for several species-specific factors. Phylogenetic analysis reveals that while the core carrier domain of slc25a25 is highly conserved across vertebrates (>75% sequence identity), the regulatory calcium-binding domains show greater divergence (approximately 60-65% identity between amphibians and mammals). This suggests potentially different calcium sensitivities and regulatory mechanisms. Developmental timing also differs significantly; processes requiring slc25a25 function occur approximately 1.5-2 times faster in Xenopus tropicalis than in Xenopus laevis, and with even greater differences compared to mammalian models. Temperature optima for protein function likely differ (25°C for Xenopus tropicalis vs. 37°C for mammalian orthologues), potentially affecting kinetic parameters and substrate affinities. Finally, tissue-specific expression patterns vary between species, reflecting adaptations to different physiological demands. These factors necessitate careful validation when transferring findings between model systems .

What are common causes of inconsistent results in slc25a25 functional assays and how can they be addressed?

Inconsistent results in slc25a25 functional assays can stem from multiple sources that require systematic troubleshooting. Protein quality variations represent a primary concern; recombinant slc25a25 is susceptible to aggregation during purification, particularly when expressed in bacterial systems. Implementing additional purification steps including ion exchange chromatography after initial affinity purification can improve consistency. Calcium contamination in buffers significantly affects activity measurements; using calcium-free buffers with precise addition of EGTA-buffered calcium solutions ensures reproducible calcium concentrations. For liposome reconstitution assays, lipid composition dramatically influences transport activity; standardizing to a defined mixture (e.g., 70% phosphatidylcholine, 20% phosphatidylethanolamine, 10% cardiolipin) improves consistency. Temperature control during assays is particularly critical for Xenopus tropicalis proteins, which show optimal activity at 25°C rather than standard mammalian assay temperatures (37°C). Finally, thorough characterization of protein oligomeric state before functional assays helps identify inactive aggregates that can skew results .

How can researchers overcome challenges in detecting low-abundance slc25a25 expression in specific tissues?

Detecting low-abundance slc25a25 expression in specific tissues requires optimized strategies beyond standard protocols. For RNA detection, digital droplet PCR (ddPCR) provides superior sensitivity compared to conventional qPCR, with reliable detection of as few as 10 transcript copies per sample. Tissue-specific RNA isolation techniques, such as laser capture microdissection prior to RNA extraction, can enrich for specific cell populations expressing slc25a25. At the protein level, signal amplification methods enhance Western blot sensitivity; tyramide signal amplification (TSA) can improve detection limits by 10-100 fold compared to standard chemiluminescence. For immunohistochemistry, antigen retrieval optimization is critical; for Xenopus tropicalis tissues, citrate buffer (pH 6.0) with heat treatment (95°C for 15 minutes) typically yields optimal results. When generating new antibodies, targeting less conserved regions of slc25a25 (typically in the N-terminal domain) produces more specific reagents. Finally, proximity ligation assays offer superior sensitivity for detecting protein-protein interactions involving low-abundance slc25a25 in tissue sections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.