Recombinant Xenopus tropicalis Coiled-coil domain-containing protein 167 (ccdc167)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

CCDC167 is encoded by the ccdc167 gene (Entrez Gene ID: 100125155) in Xenopus tropicalis. Key characteristics include:

PropertyValue
Gene Symbolccdc167
Full NameCoiled-coil domain-containing protein 167
Protein Length97 amino acids (full-length)
OrganismXenopus tropicalis (tropical clawed frog)
DomainCoiled-coil motif (involved in protein-protein interactions)

The protein’s coiled-coil domain suggests roles in structural organization or scaffold formation, potentially influencing mitotic processes or signaling pathways .

Production and Characteristics

Recombinant CCDC167 is typically expressed in E. coli with an N-terminal His-tag for purification. Key production parameters include:

ParameterValue
Expression HostE. coli
TagHis-tag (for affinity chromatography)
Purity>90% (SDS-PAGE confirmed)
Storage BufferTris/PBS-based buffer (pH 8.0) with 6% trehalose
Storage-20°C/-80°C (aliquots recommended)

The recombinant protein’s stability and solubility are optimized for biochemical assays, including ELISA, Western blot, or interaction studies .

Functional Associations and Interactions

CCDC167 interacts with diverse cellular components and pathways, as inferred from functional databases:

Key Functional Partners

ProteinFunction
ARFGEF3Regulates insulin granule biogenesis in pancreatic β-cells
CHMP7Involved in nuclear envelope sealing during mitosis
SAC3D1Promotes centrosome duplication and mitotic progression
LRRTM4Excitatory synaptogenesis in neuronal systems

These interactions suggest CCDC167 may regulate organelle dynamics, cell division, or synaptic plasticity.

Pathway Involvement

  • Cell Cycle Regulation: APC-CDH1 complex-mediated mitotic progression.

  • Immune Response: Interferon (IFN)-α/β signaling and MHC class I antigen presentation.

  • Ubiquitination: Metabolism of ubiquitin-like modifiers (e.g., SUMO).

Research Applications

Recombinant CCDC167 is utilized in studies probing its role in disease and basic biology:

ELISA Applications

ParameterDetail
ProductXenopus CCDC167 ELISA kit (50 µg vial)
SensitivityOptimized for detecting endogenous or recombinant CCDC167
ApplicationsQuantifying protein levels in lysates or conditioned media

Cancer Research Insights

While human CCDC167 is implicated in breast cancer progression, the recombinant Xenopus protein may serve as a model for studying:

  • Proliferation: Knockdown reduces colony formation in breast cancer cell lines (e.g., MCF-7).

  • Drug Response: Chemotherapeutic agents (e.g., doxorubicin) downregulate CCDC167 expression.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
ccdc167; Coiled-coil domain-containing protein 167
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-97
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
ccdc167
Target Protein Sequence
MGKKKKEKLSVAREIDGMEEKVALCKYNLDVIDVKLRKMELTEEGRKSLEKEKSSLSSRL SNYERELKSLRHENRKNMLLSVAIFLLFAVGYYCWTL
Uniprot No.

Target Background

Database Links

KEGG: xtr:100125155

UniGene: Str.52526

Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.