Recombinant Xenopus tropicalis Coiled-coil domain-containing protein 90B, mitochondrial (ccdc90b)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xenopus Tropicalis Coiled-Coil Domain-Containing Protein 90B, Mitochondrial (ccdc90b)

Recombinant Xenopus tropicalis Coiled-coil domain-containing protein 90B, mitochondrial (ccdc90b) is a protein expressed in E. coli, with an N-terminal His tag fused to it . The protein is derived from the Xenopus tropicalis, also known as the western clawed frog or Silurana tropicalis .

Xenopus Tropicalis as a Model Organism

Xenopus tropicalis serves as a valuable model organism in genetic and genomic research due to its relatively short generation time and diploid genome . The genome of X. tropicalis exhibits a remarkable degree of synteny with mammalian genomes, which makes it particularly useful in the study of complex genetic pathways .

Key Features of Recombinant ccdc90b Protein

FeatureDescription
Cat.No.RFL7149XF
Product OverviewRecombinant Full Length Xenopus tropicalis Coiled-coil domain-containing protein 90B, mitochondrial(ccdc90b) Protein (Q6DJ87) (48-267aa), fused to N-terminal His tag, was expressed in E. coli .
SpeciesXenopus tropicalis (Western clawed frog) (Silurana tropicalis)
SourceE. coli
TagHis
Protein LengthFull Length of Mature Protein (67-262)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionBriefly centrifuge the vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Default final concentration of glycerol is 50% .
Gene Namemcur1
Synonymsmcur1; ccdc90a; Mitochondrial calcium uniporter regulator 1; MCU regulator 1; Coiled-coil domain-containing protein 90A, mitochondrial
UniProt IDQ0P4J6

CCDC90B in Other Species

CCDC90B is found in various organisms, including:

  • Macaca mulatta (Rhesus monkey)

  • Canis lupus familiaris (dog)

  • Bos taurus (cattle)

  • Rattus norvegicus (Norway rat)

  • Gallus gallus (chicken)

  • Mus musculus (house mouse)

  • Homo sapiens (human)

  • Pan troglodytes (chimpanzee)

  • Danio rerio (zebrafish)

Macaca mulatta (Rhesus Monkey) CCDC90B Gene Information

FeatureDescription
Gene SymbolCCDC90B
Entrez Gene ID702035
Full Namecoiled-coil domain containing 90B
Gene Typeprotein-coding
OrganismMacaca mulatta (Rhesus monkey)
mRNAXM_015115292.1, XM_015115291.1, NM_001260811.1, XM_028832597.1, XM_015115292.2, XM_028832596.1, XM_015115291.2
ProteinXP_014970778.1, XP_014970777.1, NP_001247740.1, XP_028688430.1, XP_014970778.1, XP_028688429.1, XP_014970777.1
Namecoiled-coil domain-containing protein 90B, mitochondrial isoform X1
CloneIDOMb03350, OMb47553
Related AccessionNM_001260811.1, XM_015115292.1, XM_015115291.1, XM_015115292.2, XM_015115291.2
Accession VersionNM_001260811.1, XM_015115292.1

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ccdc90b; Coiled-coil domain-containing protein 90B, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
48-267
Protein Length
Full Length of Mature Protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
ccdc90b
Target Protein Sequence
ATSAALPAGYDVRQVEITPLEQRKLTFDTHALVRELETHGFDKVQAETIVSALATLTNAS IDTVYRDMVTRAQQEITVQQIMAHLDSIRKDMVILEKSEFATLRAENEKMKIELEHVRQH LLNETNRISADAKLDMNLERSRLTDLFTEQEKKLMEASTEFHKKNATTDSVITEINKKID IDIASLKTLMESHKLDTVRYMAASVFTCLAIALGFYRLWK
Uniprot No.

Target Background

Database Links
Protein Families
CCDC90 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

How conserved is ccdc90b across vertebrate species?

Analysis of sequence conservation indicates that ccdc90b is moderately conserved across vertebrate species. While specific conservation data for ccdc90b is limited in the available resources, comparative sequence analysis with similar proteins such as TACC family members in Xenopus shows approximately 50% identity across species, with functional domains showing higher conservation (up to 80% in conserved domains) .

What is the predicted cellular localization and function of ccdc90b?

Ccdc90b is primarily localized to mitochondria as indicated by its full name (Coiled-coil domain-containing protein 90B, mitochondrial). GO term prediction studies have successfully identified the cellular component location of CCDC90B using computational approaches such as I-TASSER/COFACTOR .

Functionally, while the specific role of ccdc90b in Xenopus tropicalis is not fully characterized in the provided resources, its mitochondrial localization suggests involvement in:

  • Mitochondrial transport processes

  • Mitochondrial organization or dynamics

  • Potential roles in mitochondrial protein complexes

  • Energy metabolism pathways

What are the optimal storage and handling conditions for recombinant ccdc90b?

Based on product information for recombinant ccdc90b, optimal storage conditions are:

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Long-term storage: -20°C or -80°C for extended preservation

  • Working aliquots: Store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this may reduce protein activity and stability

For experiments requiring active protein, researchers should thaw aliquots on ice and maintain cold chain throughout experimental procedures.

What expression systems are suitable for producing recombinant ccdc90b?

While the search results don't specify the exact expression system used for the referenced recombinant ccdc90b, standard approaches for similar mitochondrial proteins include:

  • Bacterial expression systems (E. coli):

    • Advantages: High yield, cost-effective

    • Limitations: May lack post-translational modifications

    • Recommended for structural studies or antibody production

  • Eukaryotic expression systems:

    • Mammalian cell lines (e.g., HEK293T cells) for functional studies

    • Xenopus oocytes for expression of Xenopus proteins in a native-like environment

The choice should depend on experimental goals, required protein folding, and post-translational modifications needed for functional studies.

How can I perform loss-of-function analysis for ccdc90b in Xenopus tropicalis?

While specific protocols for ccdc90b are not detailed in the search results, general approaches for loss-of-function analysis in Xenopus include:

  • Morpholino-based knockdown:

    • Design morpholinos targeting the ATG start site or splice sites

    • Inject into early embryos (1-2 cell stage)

    • Validate knockdown efficiency by Western blot

  • CRISPR-Cas9 genome editing:

    • Design guide RNAs targeting early exons of ccdc90b

    • Validate editing efficiency by sequencing and protein expression analysis

    • Analyze phenotypes in F0 or establish knockout lines

  • Dominant negative approaches:

    • Express truncated versions lacking specific functional domains

    • Analyze resulting phenotypes for insights into normal function

Each approach has advantages and limitations; selection should be based on specific research questions and available resources.

What methods are effective for identifying ccdc90b interaction partners?

To identify interaction partners of ccdc90b, affinity purification coupled with mass spectrometry (AP-MS) represents a powerful approach. Based on similar studies for other proteins:

  • Experimental design:

    • Express tagged versions of ccdc90b (potential tags: Myc, Flag, or 2B8 as used for other proteins)

    • Perform immunoprecipitation using antibodies against the tags

    • Identify co-precipitated proteins by mass spectrometry

  • Validation strategies:

    • Co-immunoprecipitation with candidate interactors

    • Proximity labeling approaches (BioID, APEX)

    • Co-localization studies using immunofluorescence

    • Functional validation through co-expression studies

For instance, a protocol similar to that used for C11orf52 could be adapted, where "transient transfection of plasmid DNA containing [protein] and three epitope tags (Myc, Flag, and 2B8) was performed using a Turbofect device," followed by cell lysis and immunoprecipitation .

How can I study ccdc90b localization within Xenopus cells?

To study subcellular localization of ccdc90b:

  • Immunofluorescence approaches:

    • Use antibodies against native ccdc90b or epitope tags on recombinant protein

    • Co-stain with mitochondrial markers (e.g., MitoTracker)

    • Analyze using confocal microscopy

  • Live-cell imaging with fluorescent fusion proteins:

    • Generate GFP- or mCherry-tagged ccdc90b constructs

    • Express in Xenopus embryonic cells

    • Monitor localization and dynamics in live cells

Similar approaches have been successful for studying other proteins in Xenopus cells, such as TACC1 where "GFP-TACC1 localized to the growing plus-ends of MTs in mesenchymal cells derived from the neural tube" .

What experimental approaches can determine if ccdc90b functions in mitochondrial transport?

To investigate potential roles in mitochondrial transport:

  • Mitochondrial motility assays:

    • Knockdown or overexpress ccdc90b in Xenopus cells

    • Label mitochondria with fluorescent markers

    • Track mitochondrial movement using time-lapse microscopy

    • Analyze transport parameters (speed, distance, directionality)

  • Mitochondrial fractionation:

    • Isolate mitochondria from ccdc90b-manipulated and control cells

    • Analyze mitochondrial protein composition by Western blot or proteomics

    • Identify changes in transport-related proteins

  • Functional assays:

    • Measure mitochondrial membrane potential using fluorescent indicators

    • Assess mitochondrial calcium handling

    • Evaluate respiratory chain activity in ccdc90b-manipulated cells

Similar approaches have been used to study mitochondrial transport proteins in other contexts .

How can computational prediction tools enhance understanding of ccdc90b function?

Computational prediction represents a powerful approach to generate functional hypotheses about ccdc90b:

  • GO term prediction using I-TASSER/COFACTOR:

    • This approach has successfully identified cellular component localization of CCDC90B

    • The method generates GO terms with associated confidence scores

    • Results can be filtered using specialized algorithms to improve precision

  • Implementation approach:

    • Generate structural models of ccdc90b using I-TASSER

    • Use COFACTOR to predict GO terms based on structural similarity

    • Apply filtering algorithms to select specific GO terms with higher precision-recall scores

    • Validate predictions experimentally

Research has shown that "187 specific GO terms showed a higher av. precision-recall score at the least cellular component term compared to 2413 predicted GO terms" when using this approach for similar proteins .

What is known about the expression and regulation of ccdc90b during Xenopus development?

While specific information about ccdc90b expression patterns in Xenopus development is not detailed in the search results, approaches to study developmental expression include:

  • RT-PCR analysis across developmental stages:

    • Similar to approaches used for TACC family proteins where "RT-PCR of Xenopus laevis cDNA libraries from various developmental time points and tissues" revealed expression patterns

    • Compare expression in neural, epidermal, and mesoendodermal tissues

  • In situ hybridization:

    • Develop specific probes for ccdc90b mRNA

    • Analyze spatial expression patterns in embryos at different stages

  • Protein expression analysis:

    • Western blotting of embryonic tissues at different stages

    • Immunohistochemistry to localize protein expression spatially

These approaches would provide insights into the developmental roles of ccdc90b, potentially revealing stage- or tissue-specific functions.

How does ccdc90b function compare between Xenopus and mammalian systems?

Comparative functional analysis between Xenopus and mammalian ccdc90b provides evolutionary insights:

  • Sequence and structural comparison:

    • Align sequences to identify conserved domains and species-specific variations

    • Predict structural differences that might impact function

    • Identify conserved post-translational modification sites

  • Cross-species functional rescue experiments:

    • Rescue ccdc90b knockdown in Xenopus with mammalian homologs

    • Quantify rescue efficiency to determine functional conservation

    • Identify domains required for conserved functions

  • Interaction partner analysis:

    • Compare interaction networks between species

    • Identify conserved and species-specific interactors

    • Determine if molecular mechanisms are conserved across vertebrates

Similar comparative approaches have been applied to TACC proteins, where functional differences were observed between Xenopus and human systems despite sequence conservation .

What quality control measures should be employed when working with recombinant ccdc90b?

Rigorous quality control is essential for reliable research with recombinant proteins:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining to verify size and purity

    • Western blot with specific antibodies to confirm identity

    • Mass spectrometry for definitive identification

  • Functional validation:

    • Activity assays appropriate to predicted function

    • Binding assays with known or predicted partners

    • Structural integrity assessment (circular dichroism, thermal shift assays)

  • Batch-to-batch consistency:

    • Maintain detailed records of protein preparation and quality metrics

    • Consider aliquoting single preparations for longitudinal studies

    • Include positive controls in functional assays to normalize between batches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.