Recombinant Xenopus tropicalis Cornichon homolog 2 (cnih2)

Shipped with Ice Packs
In Stock

Description

Introduction to Xenopus tropicalis and its Genetic Significance

Xenopus tropicalis, a small, fast-breeding, diploid frog species closely related to Xenopus laevis, has emerged as a significant model organism in developmental genetics and functional genomics . Its adoption is due to its suitability for multigenerational genetic, genomic, and transgenic approaches, offering a more straightforward genome and a shorter generation time compared to X. laevis . The close evolutionary relationship between X. tropicalis and X. laevis ensures shared developmental features and conserved gene sequences, making X. tropicalis attractive to researchers already working with X. laevis .

Key advantages of using Xenopus tropicalis in genetic research:

  • Diploid Genome: Unlike the allotetraploid genome of X. laevis, the diploid genome of X. tropicalis simplifies genetic studies and comparative gene function analysis with mammalian species .

  • Genomic Resources: The sequencing of the X. tropicalis genome by the Department of Energy’s Joint Genome Institute (JGI) in 2010 has provided a primary platform for research in genetics and genomics within the Xenopus community .

  • Mutagenesis and Transgenesis: Xenopus embryos are amenable to genetic manipulation techniques like gynogenesis, which facilitates the identification of recessive phenotypes, and the creation of stable transgenic lines for in vivo reporter assays and experimental gene expression manipulation .

Understanding Cornichon Homolog 2 (cnih2)

Cornichon homolog 2 (cnih2) in Xenopus tropicalis is an AMPA receptor auxiliary protein that regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs) .

  • Gene Information: Xenopus tropicalis cornichon family AMPA receptor auxiliary protein 2 (cnih2), transcript variant X1, mRNA is available as an ORF clone .

Research Applications and Findings

Xenopus tropicalis is used as a model for CRISPR-mediated genome editing . A method for CRISPR-mediated genome editing in Xenopus oocytes with homology-directed repair (HDR) allows efficient non-mosaic targeted insertion of small DNA fragments in F0 tadpoles, with germline transmission . The gene-edited F0 embryos are uniformly heterozygous, indicating a mutation in the maternal genome . This HDR methodology facilitates in vivo protein tagging and the creation of patient-specific mutations for human disease modeling in Xenopus .

CNIH2 and Esophageal Squamous Cell Carcinoma

CPSF3 regulates alternative polyadenylation of CNIH2 to promote esophageal squamous cell carcinoma progression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cnih2; Protein cornichon homolog 2; CNIH-2; Cornichon family AMPA receptor auxiliary protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
cnih2
Target Protein Sequence
MAFTFAAFCYMLTLVLCASLIFFIIWHIIAFDELRTDFKNPIEQGNPSRARERVKNVERI CCLLRKLVVPEYCIHGLFCLMFMCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMFDPV SIMNVDILNYCQKEAWCKLAFYLLSFFYYLYRVGATVRYVSA
Uniprot No.

Target Background

Function
Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs).
Database Links
Protein Families
Cornichon family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Cornichon homolog 2 (cnih2) and why is it studied in Xenopus tropicalis?

Cornichon homolog 2 (cnih2) is a protein originally identified in Xenopus tropicalis (Western clawed frog) with significant roles in modulating AMPA receptor function and trafficking. It is studied in Xenopus tropicalis because this diploid species serves as an excellent model organism for genetics and genomics research, having diverged from Xenopus laevis approximately 50 million years ago . Unlike Xenopus laevis which underwent genome duplication, Xenopus tropicalis is the only known diploid species in the Xenopus genus, making it more suitable for genetic studies and comparative analyses with mammalian systems . The diploid gene structure and function in Xenopus tropicalis is more likely to be conserved with mammalian species, providing advantages for comparative gene function and regulation studies .

How does cnih2 function in neuronal systems?

In neuronal systems, cnih2 functions primarily as an auxiliary protein for AMPA receptors, which are important for fast excitatory neurotransmission. Specifically, cnih2 has multiple roles:

  • It promotes surface trafficking of AMPA receptors, particularly in hippocampal neurons .

  • It enhances the gating of recombinant AMPA receptors, affecting their electrophysiological properties .

  • It modulates AMPA receptor auxiliary subunit assembly by regulating the number of Transmembrane AMPA Receptor regulatory Proteins (TARPs) within an AMPA receptor complex .

  • It acts synergistically with γ-8 (a TARP) in hippocampal neurons to regulate AMPA receptor pharmacology and gating .

  • It shows regional specificity in function - it associates with AMPA receptors on the neuronal surface in hippocampal neurons but does not reach the neuronal surface in cerebellar Purkinje neurons .

This differential behavior across brain regions suggests tissue-specific regulatory mechanisms controlling cnih2 function.

What are the optimal storage and handling conditions for recombinant Xenopus tropicalis cnih2?

For optimal preservation of recombinant Xenopus tropicalis cnih2 activity and stability, the following storage and handling protocols are recommended:

  • Long-term storage: Store at -20°C, or at -80°C for extended storage periods .

  • Working conditions: Working aliquots can be maintained at 4°C for up to one week .

  • Buffer composition: The protein is optimally preserved in a Tris-based buffer containing 50% glycerol .

  • Avoiding degradation: Repeated freezing and thawing should be strictly avoided as it leads to protein denaturation and loss of activity .

  • Aliquoting strategy: Upon receiving the recombinant protein, it is advisable to prepare multiple small-volume aliquots to minimize freeze-thaw cycles.

These conditions ensure that the structural integrity and functional properties of the recombinant protein are maintained throughout experimental procedures.

How can recombinant cnih2 be used in AMPA receptor studies?

Recombinant cnih2 can be utilized in AMPA receptor studies through several methodological approaches:

  • Co-expression systems: Recombinant cnih2 can be co-expressed with GluA subunits (AMPA receptor subunits) in heterologous expression systems such as HEK293 cells or Xenopus oocytes to study its effects on receptor trafficking and function .

  • Electrophysiological assessments: Patch-clamp recordings can be performed to analyze how cnih2 modifies AMPA receptor properties including:

    • Desensitization and resensitization kinetics

    • Channel conductance

    • Response to agonists and antagonists

  • Receptor stoichiometry analysis: Experiments can be designed using tagged constructs to determine how cnih2 affects the number of TARPs incorporated into AMPA receptor complexes .

  • Pharmacological profiling: cnih2 modifies the pharmacological properties of AMPA receptors, making them respond differently to drugs and modulators. This can be assessed using various agonists and antagonists .

  • Surface expression studies: Biotinylation assays or immunofluorescence techniques can be employed to quantify how cnih2 affects surface expression of AMPA receptors.

The data indicates that coexpression of cnih2 with GluA/TARP complexes reduces TARP stoichiometry within AMPA receptors, providing a unique tool for studying receptor assembly and modulation .

How does cnih2 modulate TARP stoichiometry in AMPA receptor complexes?

CNIH-2 has been definitively shown to reduce TARP stoichiometry within AMPA receptor complexes through a mechanism that affects receptor assembly. The modulation occurs as follows:

  • Competitive incorporation: CNIH-2 competes with TARPs for binding sites within the AMPA receptor complex, resulting in fewer TARP subunits per receptor .

  • Stoichiometry-dependent properties: Research using tandem GluA-TARP constructs has demonstrated that resensitization is a feature specific to four-TARP-containing AMPA receptors but not two-TARP-containing receptors .

  • Blockade of resensitization: CNIH-2 blocks the resensitization process by reducing the number of TARPs per AMPA receptor complex .

  • Tissue-specific effects: In hippocampal neurons, CNIH-2 associates with AMPA receptors on the neuronal surface in a γ-8-dependent manner, whereas in cerebellar Purkinje neurons, CNIH-2 does not reach the neuronal surface .

  • Physiological relevance: In stargazer Purkinje neurons (lacking γ-2 but expressing γ-7 and CNIH-2), AMPA receptors exhibit electrophysiological properties that resemble those of recombinant receptors with low γ-7 stoichiometry without CNIH-2 .

This mechanism provides critical insight into how auxiliary proteins fine-tune AMPA receptor function, potentially contributing to synapse-specific and cell-type-specific differences in glutamatergic signaling.

What explains the regional differences in cnih2 function between hippocampal and cerebellar neurons?

The functional differences of cnih2 between hippocampal and cerebellar neurons appear to be governed by several interrelated factors:

  • TARP isoform dependency: In hippocampal neurons, CNIH-2 surface expression depends specifically on the presence of γ-8 TARP. This isoform-specific interaction suggests that different TARP isoforms have varying affinities or structural compatibilities with CNIH-2 .

  • Surface trafficking regulation: In cerebellar Purkinje neurons, CNIH-2 fails to reach the neuronal surface despite being expressed in these cells. This indicates the existence of region-specific trafficking mechanisms or retention signals that prevent CNIH-2 from being incorporated into surface-expressed AMPA receptor complexes in these neurons .

  • Differential TARP expression patterns: Hippocampal regions predominantly express γ-8, whereas cerebellar preparations predominantly express TARPs γ-2 and γ-7. These distinct TARP expression profiles likely contribute to the regional differences in CNIH-2 function .

  • Synergistic effects: In hippocampal neurons, CNIH-2 acts synergistically with γ-8 to regulate AMPA receptor pharmacology and gating, suggesting a cooperative interaction that may not occur with other TARP isoforms .

  • Subcellular localization differences: The data suggests that in cerebellar neurons, CNIH-2 may be restricted to intracellular compartments like the Golgi, where it only promotes trafficking of AMPA receptors without modulating their function at the cell surface .

These regional differences reveal sophisticated mechanisms for fine-tuning glutamatergic signaling in different brain areas, potentially contributing to specialized synaptic functions.

What advantages does Xenopus tropicalis offer for studying cnih2 compared to other model organisms?

Xenopus tropicalis offers several distinct advantages for studying cnih2 function:

  • Diploid genome: Unlike the tetraploid Xenopus laevis, Xenopus tropicalis is diploid, making it more amenable to genetic manipulation and analysis . This simplifies the interpretation of genetic modifications targeting cnih2.

  • Evolutionary context: As an amphibian model, Xenopus tropicalis represents an important evolutionary position between fish and mammals, allowing researchers to study conserved and divergent aspects of cnih2 function across vertebrate evolution .

  • Developmental accessibility: The external development of Xenopus embryos allows easy visualization and manipulation of developmental processes that might be influenced by cnih2, particularly in the developing nervous system.

  • Tissue chimera capabilities: Xenopus systems allow for the creation of tissue chimeras, enabling researchers to determine whether phenotypes associated with cnih2 mutations are due to lesions in genes acting within specific tissues or due to failure in inductive signals from adjacent tissues .

  • Gynogenetic screening: The ability to generate haploid embryos and subsequently diploidize them through cold shock provides an efficient method for revealing recessive mutations in cnih2, saving considerable time and resources compared to traditional three-generation screening methods .

  • Established genetic tools: The availability of reliable genetic maps based on simple sequence length polymorphisms (SSLPs) facilitates the mapping of genetic lesions in Xenopus tropicalis, including those affecting cnih2 function .

These advantages make Xenopus tropicalis particularly valuable for comprehensive studies of cnih2 function in development, neurobiology, and cellular signaling.

How can CRISPR-Cas9 technology be applied to study cnih2 function in Xenopus tropicalis?

CRISPR-Cas9 technology can be effectively applied to study cnih2 function in Xenopus tropicalis through several sophisticated approaches:

  • Targeted gene knockout: CRISPR-Cas9 can generate precise indel mutations in the cnih2 gene by designing sgRNAs targeting specific exonic regions. The Xenopus oocyte host transfer method has demonstrated high efficiency in creating non-mosaic knockouts with germline transmission, allowing for the analysis of complete loss-of-function phenotypes .

  • Precision knock-in modifications: Homology-directed repair (HDR) can be employed alongside CRISPR-Cas9 to introduce epitope tags (such as FLAG) to the C-terminus of cnih2, enabling protein visualization and interaction studies without disrupting function . The efficiency of knock-in can reach approximately 8.5% when using the oocyte host transfer method .

  • Domain-specific mutations: CRISPR-Cas9 with HDR can introduce specific amino acid substitutions to examine the functional importance of particular domains or residues within the cnih2 protein, particularly those involved in AMPA receptor interaction.

  • Methodology optimization: For Xenopus tropicalis specifically:

    • Collagenase VII treatment enables isolation of oocytes that remain competent for fertilization after host transfer

    • The repair oligo should be a 200-base single-stranded oligonucleotide with 40-45 bases of homologous sequence spanning the targeted locus

    • Introduction of 2-4 silent mutations in the sgRNA targeting sequence prevents Cas9 from cutting after successful recombination

  • Off-target analysis: Potential off-target sites can be screened by allowing two mismatches in sgRNA targeting sequence using tools like GGGenome (https://gggenome.dbcls.jp/) and tested by T7E1 endonuclease assay .

This approach provides powerful tools for dissecting cnih2 function in vivo, allowing researchers to examine its role in AMPA receptor modulation and neural development within the context of the whole organism.

What experimental approaches can resolve contradictory findings about cnih2 cellular localization and function?

The contradictory findings regarding cnih2 cellular localization and function can be resolved through several methodological approaches:

  • Cell-type specific imaging techniques:

    • Super-resolution microscopy combined with specific antibodies or epitope-tagged cnih2 to precisely localize the protein in different neuronal populations

    • Live-cell imaging using pH-sensitive fluorescent tags (pHluorin) to specifically track surface-expressed cnih2 versus intracellular pools

  • Biochemical fractionation with controls:

    • Rigorous surface biotinylation assays with appropriate controls to quantitatively assess surface versus intracellular cnih2 in different brain regions

    • Density gradient fractionation to determine subcellular compartmentalization in hippocampal versus cerebellar neurons

  • Molecular manipulation of trafficking:

    • Identification and mutation of potential retention/export signals in cnih2 to determine sequences responsible for differential trafficking

    • Co-expression of different TARP isoforms (γ-2, γ-7, γ-8) with cnih2 to systematically assess their effects on cnih2 surface expression

  • Conditional expression systems:

    • Cell-type specific and temporally controlled expression of cnih2 using Cre-lox or tetracycline-inducible systems in Xenopus

    • Generation of chimeric proteins between cerebellar-expressed and hippocampal-expressed cnih2 to identify domains responsible for differential localization

  • Quantitative stoichiometry assessment:

    • Use of single-molecule imaging techniques to precisely count the number of TARP and cnih2 molecules in individual AMPA receptor complexes

    • Application of FRET sensors to measure protein-protein interactions between cnih2, TARPs, and AMPA receptor subunits in living neurons

How does Xenopus tropicalis cnih2 compare structurally and functionally to mammalian orthologs?

A comparative analysis of Xenopus tropicalis cnih2 and its mammalian orthologs reveals important evolutionary insights:

SpeciesSequence SimilarityFunctional ConservationKey Structural DifferencesTissue Expression Pattern
Xenopus tropicalis100% (reference)Modulates AMPA receptor trafficking and function162 amino acids, full-length proteinNeural tissues, developmental expression
Human~75-80%*Conserved role in AMPA receptor modulationAdditional regulatory motifs in C-terminal domain*Broadly expressed in CNS, highest in hippocampus
Mouse~75%*Similar effects on TARP stoichiometrySlightly altered transmembrane domains*Prominent in hippocampus, cerebellum, and cortex
Rat~74%*Functionally analogousDivergence in N-terminal signal sequence*Similar to mouse, regulated during development

*Estimated values based on typical conservation patterns between amphibian and mammalian proteins, as specific comparison data was not provided in the search results.

The functional conservation across species underscores the fundamental importance of cnih2 in glutamatergic signaling throughout vertebrate evolution. The structural differences, particularly in regulatory domains, likely reflect adaptations to species-specific signaling requirements and interacting partners. Studies in Xenopus tropicalis can therefore provide valuable insights into both conserved mechanisms and evolutionary adaptations in AMPA receptor regulation.

What methodological challenges exist when extrapolating cnih2 function from Xenopus to mammalian systems?

Several methodological challenges must be addressed when extrapolating findings about cnih2 from Xenopus tropicalis to mammalian systems:

  • Subunit composition differences:

    • Mammals express multiple AMPA receptor subunits (GluA1-4) with complex splicing patterns

    • The specific interactions between cnih2 and these different subunit combinations may vary between species

    • Experimental design must account for these differences when interpreting functional outcomes

  • Expression pattern variations:

    • The regional and developmental expression patterns of cnih2 and TARPs may differ between amphibians and mammals

    • Cell-type specific expression analysis should be performed in both systems to establish true functional homology

  • Signaling pathway integration:

    • The broader signaling networks in which cnih2 functions may have evolved differently

    • Comprehensive interactome studies are needed to map species-specific protein-protein interactions

  • Technical considerations:

    • Temperature-dependent effects: Xenopus is adapted to lower temperatures than mammals, potentially affecting protein kinetics

    • Heterologous expression systems must be carefully selected to provide appropriate cellular contexts

    • When using Xenopus oocytes for expression studies, the potential influence of endogenous Xenopus proteins must be controlled for

  • Validation requirements:

    • Findings in Xenopus should be validated in mammalian systems using multiple approaches:

      • Primary neuronal cultures

      • Brain slice preparations

      • In vivo genetic manipulations in rodents

    • Functional assays should include both electrophysiological and biochemical measurements

By systematically addressing these challenges, researchers can effectively translate discoveries about cnih2 function from the Xenopus model to mammalian systems, advancing our understanding of AMPA receptor regulation across vertebrate species.

What emerging technologies could advance the study of cnih2 function in synaptic plasticity?

Several cutting-edge technologies hold promise for deepening our understanding of cnih2's role in synaptic plasticity:

  • Cryo-electron microscopy:

    • High-resolution structural analysis of cnih2 in complex with AMPA receptors and TARPs

    • Visualization of conformational changes that occur during receptor activation and modulation

    • Mapping of precise interaction interfaces to guide structure-based drug design

  • Optogenetic and chemogenetic tools:

    • Development of light-activated or ligand-activated cnih2 variants to temporally control its function

    • Creation of tools to rapidly recruit or remove cnih2 from receptor complexes in living neurons

    • Integration with electrophysiological recordings to correlate cnih2 dynamics with synaptic function

  • Single-synapse imaging and manipulation:

    • Utilization of expanded microscopy techniques to visualize cnih2 distribution at individual synapses

    • Application of two-photon glutamate uncaging combined with cnih2 manipulation to assess synapse-specific functions

    • Development of synapse-specific CRISPR delivery to modify cnih2 at selected connections

  • Proteomics and interactomics:

    • Proximity labeling approaches (BioID, APEX) to identify the cnih2 interactome in different neuronal compartments

    • Quantitative cross-linking mass spectrometry to map dynamic protein interactions during synaptic plasticity

    • Targeted proteomics to measure stoichiometric changes in protein complexes following plasticity induction

  • In vivo approaches:

    • Development of cnih2 sensors to monitor its activity or conformational state during learning and memory

    • Application of in vivo CRISPR screens to identify modulators of cnih2 function

    • Integration of behavioral assays with molecular manipulations of cnih2 to establish causal relationships

These technologies, particularly when applied in combination, will provide unprecedented insights into how cnih2 contributes to synaptic plasticity mechanisms that underlie learning and memory, potentially revealing new therapeutic targets for neurological disorders.

How might understanding cnih2 function contribute to therapeutic approaches for neurological disorders?

Understanding cnih2 function could significantly impact therapeutic approaches for neurological disorders through several mechanisms:

  • Targeting glutamatergic dysfunction:

    • Epilepsy: cnih2's role in modulating AMPA receptor kinetics could inform the development of novel anticonvulsants that normalize excessive glutamatergic signaling

    • Neurodegenerative disorders: Modulation of cnih2 function might protect against excitotoxicity in conditions like Alzheimer's disease and amyotrophic lateral sclerosis

    • Psychiatric disorders: Abnormal glutamatergic signaling in schizophrenia and major depression could potentially be addressed by targeting cnih2-mediated regulation

  • Region-specific intervention strategies:

    • The differential function of cnih2 in hippocampal versus cerebellar neurons provides a foundation for developing region-specific therapeutic approaches

    • This regional specificity could reduce side effects by allowing targeted modulation of glutamatergic signaling in affected brain regions while sparing others

  • Precision medicine approaches:

    • Genetic variation in cnih2 or its interacting partners could be used to stratify patients and predict treatment responses

    • Personalized therapeutic strategies could be developed based on individual differences in AMPA receptor auxiliary protein expression

  • Drug development opportunities:

    • Structure-based drug design targeting the interface between cnih2 and AMPA receptors or TARPs

    • Development of allosteric modulators that specifically affect cnih2-containing AMPA receptor complexes

    • Creation of small molecules that modulate cnih2 trafficking to fine-tune its surface expression

  • Delivery strategies using Xenopus models:

    • The Xenopus tropicalis model provides an efficient system for screening therapeutic candidates targeting cnih2 function

    • Techniques developed for CRISPR-mediated genome editing in Xenopus could be adapted for therapeutic gene editing approaches

    • The oocyte host transfer method demonstrates principles that could inform cellular replacement therapies

By elucidating the fundamental mechanisms by which cnih2 regulates AMPA receptor function, researchers can identify novel intervention points for conditions involving glutamatergic dysregulation, potentially leading to more effective and targeted treatments with fewer side effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.