Recombinant Xenopus tropicalis Diacylglycerol O-acyltransferase 2 (dgat2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
dgat2; TEgg014n15.1; Diacylglycerol O-acyltransferase 2; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
dgat2
Target Protein Sequence
MKTIIAAYSGVLRGTGSSLLSAVHDLPNIPWLSKSSVVRHLQIISVLQWVLSFLILGVAC TAVLVYIFCTDLWLIAALYLTWMVLDWNTPYKGGRRSSWVRNWAVWRYFRDYFPIKLVKT HNLLPSRNYIFGYHPHGIMCLGAFCNFGTEATGVSKKFPGIKCHLATLAGNFRMPVLREY LMSGGICPVARDTIDYILSKNGTGNAVVIAVGGAAESLNCRPGKNTVTLKQRKGFVKVAL QHGADLVPVYSFGENEAYKQVVFEEGSWGRWIQKKFQKYVGFAPCLFHGCSFFSSNSWGL VPYANPITTVVGEPITVPKIEQPTQKDVELYHAMYVTSLQRLFDKYKTKLGLHDSEMLEI V
Uniprot No.

Target Background

Function
Recombinant Xenopus tropicalis Diacylglycerol O-acyltransferase 2 (dgat2) is an essential acyltransferase catalyzing the terminal and only committed step in triacylglycerol synthesis. It utilizes diacylglycerol and fatty acyl CoA as substrates. dgat2 is required for the synthesis and storage of intracellular triglycerides and likely plays a central role in cytosolic lipid accumulation.
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lipid droplet. Cytoplasm, perinuclear region.

Q&A

Why is Xenopus tropicalis preferred over Xenopus laevis for DGAT2 research?

Xenopus tropicalis offers several advantages over Xenopus laevis for genetic research involving DGAT2. While X. laevis is allotetraploid with larger embryos, X. tropicalis is diploid with a simpler genome that facilitates genetic manipulation and analysis . This diploid nature is particularly beneficial for studies involving recombinant protein expression and genetic modifications. The shorter generation time of X. tropicalis (4-6 months versus 1-2 years for X. laevis) allows for more rapid establishment of transgenic and mutant lines, making it more suitable for multigenerational experiments focusing on lipid metabolism genes like DGAT2 . Additionally, the genome of X. tropicalis has been fully sequenced and annotated before that of X. laevis, providing valuable genomic resources for researchers studying DGAT2 gene structure, function, and regulation .

What is the function of DGAT2 in Xenopus tropicalis?

DGAT2 in Xenopus tropicalis, as in other organisms, catalyzes the final and rate-limiting step in triacylglycerol (TAG) biosynthesis by esterifying sn-1,2-diacylglycerol with a long-chain fatty acyl-CoA . This enzyme plays a crucial role in lipid metabolism during embryonic development, as lipids serve as both structural components and energy sources. In X. tropicalis embryos, DGAT2 is involved in the accumulation of lipid stores that are essential for proper development. The enzyme is integral to membrane structures, with approximately 40% of its amino acid residues being hydrophobic, contributing to its association with the endoplasmic reticulum membrane where TAG synthesis predominantly occurs . Understanding DGAT2 function in X. tropicalis provides insights into conserved mechanisms of lipid metabolism across vertebrates and has implications for developmental biology and metabolic disease research.

How can I express recombinant Xenopus tropicalis DGAT2 in bacterial systems?

Expressing recombinant X. tropicalis DGAT2 in bacterial systems, particularly in E. coli, requires specialized approaches due to the hydrophobic nature of the protein. Based on successful strategies with other DGAT2 proteins, the recommended approach is to express the full-length DGAT2 as a fusion protein with solubility-enhancing tags . A proven method involves creating a construct with maltose binding protein (MBP) at the N-terminus and a poly-histidine (His) tag at the C-terminus of DGAT2 . This approach increases solubility while allowing for tandem affinity purification. The expression vector should contain a strong promoter such as T7, and expression conditions typically include induction with IPTG (0.1-1.0 mM) at reduced temperatures (16-20°C) to enhance proper folding . It's important to note that even with these optimizations, a significant portion of the recombinant protein may remain in the insoluble fraction or associate with bacterial membranes, requiring additional solubilization steps with detergents for recovery .

What genomic resources are available for studying DGAT2 in Xenopus tropicalis?

Researchers studying DGAT2 in Xenopus tropicalis have access to substantial genomic resources that facilitate both functional and structural investigations. The X. tropicalis genome has been fully sequenced, annotated, and is publicly available, allowing researchers to analyze the DGAT2 gene structure, regulatory elements, and evolutionary conservation . Additionally, a reliable genetic map based on simple sequence length polymorphisms (SSLPs) has been developed, which aids in mapping genetic lesions affecting DGAT2 function . For researchers interested in generating mutant lines, gynogenetic screening methods have been optimized for X. tropicalis, which can help identify the chromosomal location of mutations affecting DGAT2 . The Xenbase database serves as a comprehensive resource for X. tropicalis researchers, providing access to gene expression data, protein sequences, and tools for comparative genomics studies involving DGAT2 . These resources collectively support detailed investigations into DGAT2 structure, function, and regulation in this important vertebrate model organism.

How does the oligomeric state of recombinant Xenopus tropicalis DGAT2 impact its enzymatic activity?

The oligomeric state of recombinant X. tropicalis DGAT2 appears to be critical for its enzymatic activity, with evidence suggesting that the protein forms complex quaternary structures. Size exclusion chromatography studies of recombinant DGAT2 have estimated its molecular size to be approximately eight times the predicted monomer size (670 kDa versus 79 kDa for the monomer), indicating extensive oligomerization . Immunoblotting and mass spectrometry analyses consistently detect protein bands corresponding to dimer forms of DGAT2, even under strong denaturing conditions of SDS-PAGE, suggesting particularly stable interactions between monomers . This dimerization appears to be DGAT2-specific rather than an artifact of fusion tags, as similar dimeric forms have been observed in both bacterial expression systems with MBP-DGAT2-His fusion proteins and in yeast-expressing HA-tagged DGAT2 .

The functional significance of this oligomerization likely relates to creating optimal spatial arrangements of catalytic sites and facilitating interaction with lipid substrates within membranes. The formation of higher-order complexes may enable cooperative binding of substrates, enhancing enzymatic efficiency in the TAG synthesis pathway. Additionally, oligomerization might create microenvironments that concentrate substrates or exclude water from the active site, which is crucial for reactions involving hydrophobic lipid components. Understanding the structure-function relationship of these oligomeric forms is essential for interpreting enzymatic assays and developing strategies to modulate DGAT2 activity in research and potential therapeutic applications.

What are the challenges in purifying active recombinant Xenopus tropicalis DGAT2 and how can they be overcome?

Purifying active recombinant X. tropicalis DGAT2 presents significant challenges due to its integral membrane protein nature, with approximately 40% hydrophobic amino acid residues . Several specific obstacles and their potential solutions have been identified through experimental approaches with DGAT2 proteins:

A systematic approach combining these strategies, along with activity assays at each purification step, is crucial for obtaining functionally active recombinant DGAT2 suitable for structural and enzymatic studies.

How can CRISPR/Cas9 gene editing be optimized for studying DGAT2 function in Xenopus tropicalis?

CRISPR/Cas9 gene editing has proven highly effective in Xenopus tropicalis for generating both transient biallelic mutations in F0 embryos and stable mutant lines, making it a powerful tool for studying DGAT2 function . Optimizing this approach for DGAT2 requires consideration of several key factors:

  • Guide RNA design: For DGAT2, targeting conserved catalytic domains or transmembrane regions is most likely to generate loss-of-function phenotypes. Multiple bioinformatic tools are available to design guide RNAs with high on-target efficiency and minimal off-target effects, with 2-3 guide RNAs typically designed for each target region to increase success rates.

  • Delivery method: Microinjection into fertilized X. tropicalis eggs at the one-cell stage ensures uniform distribution of CRISPR components . For DGAT2 studies focusing on specific tissues, injections can be targeted to specific blastomeres based on the established fate map to achieve tissue-restricted mutations.

  • Confirmation of editing efficiency: Mutation efficiency can be assessed using T7 endonuclease assays, Sanger sequencing, or next-generation sequencing of PCR amplicons spanning the target region. For DGAT2 studies, establishing a direct relationship between genotype and phenotype is crucial due to potential compensatory mechanisms in lipid metabolism.

  • Phenotypic analysis: Since DGAT2 is involved in lipid metabolism, specialized assays including lipid staining (e.g., Oil Red O), lipidomic analysis, and assessment of embryonic energy stores are essential for characterizing mutant phenotypes.

  • Establishing stable lines: For multigenerational genetics, mutations in X. tropicalis DGAT2 can be maintained through careful breeding and genotyping protocols . Heterozygous carriers can be identified and bred to generate homozygous mutants if the mutation is not embryonic lethal.

  • Complementation testing: To validate that observed phenotypes are due to DGAT2 disruption rather than off-target effects, rescue experiments using wild-type mRNA injection or complementation with orthologous DGAT2 genes can be performed.

This optimized approach leverages the genetic tractability of X. tropicalis to provide definitive insights into DGAT2 function during development and in specific tissues.

What are the comparative advantages of using transgenic approaches versus morpholinos for studying DGAT2 in Xenopus tropicalis?

Both transgenic approaches and morpholinos offer distinct advantages for studying DGAT2 in Xenopus tropicalis, with the choice depending on specific research questions and experimental timelines:

Transgenic Approaches:

  • Stable and heritable modifications: Transgenic X. tropicalis lines provide consistent, heritable DGAT2 expression patterns or mutations that can be studied across generations . This is particularly valuable for studying the long-term consequences of DGAT2 dysfunction on metabolism and development.

  • Spatial and temporal control: Advanced transgenic systems using tissue-specific or inducible promoters allow precise control over when and where DGAT2 is expressed or disrupted . This can help distinguish between direct effects of DGAT2 activity and secondary consequences of altered lipid metabolism.

  • Reporter fusion proteins: Creating DGAT2-fluorescent protein fusions in transgenic lines enables real-time visualization of protein localization and dynamics in living embryos and tissues . This approach has revealed important insights about the subcellular distribution of DGAT2.

  • Reproducibility: Once established, transgenic lines provide highly reproducible experimental systems with consistent genotypes across studies . This facilitates more detailed mechanistic investigations and reduces experimental variability.

Morpholino Approaches:

  • Rapid implementation: Morpholinos targeting DGAT2 can be designed and injected into embryos within days, providing much faster results than generating transgenic lines . This allows rapid testing of hypotheses about DGAT2 function.

  • Dose-dependent studies: The amount of morpholino injected can be titrated to achieve varying degrees of DGAT2 knockdown, enabling the study of dose-dependent effects that might be difficult to achieve with null mutations .

  • Combinatorial knockdowns: Multiple morpholinos targeting different genes (e.g., DGAT2 plus other lipid metabolism enzymes) can be co-injected to study genetic interactions and redundancy in lipid metabolic pathways.

  • Targeting maternal transcripts: Morpholinos can effectively block translation of maternal DGAT2 transcripts, which might persist in zygotic mutants generated through transgenic approaches .

For comprehensive studies of DGAT2 function, a combined approach is often most effective: morpholinos provide rapid initial insights, while transgenic lines enable detailed mechanistic studies and assessment of long-term metabolic consequences.

What is the optimal protocol for expressing and purifying recombinant Xenopus tropicalis DGAT2?

Based on successful approaches with similar proteins, the following optimized protocol is recommended for expressing and purifying recombinant X. tropicalis DGAT2:

Construct Design:

  • Clone the full-length X. tropicalis DGAT2 coding sequence into an expression vector (e.g., pMAL-c2X) with MBP fusion at the N-terminus and His-tag at the C-terminus .

  • Include a precision protease cleavage site between MBP and DGAT2 to allow tag removal if required.

Expression Conditions:

  • Transform the construct into E. coli BL21(DE3) or Rosetta(DE3) strains for expression .

  • Grow cultures at 37°C to mid-log phase (OD600 = 0.6-0.8) in LB medium with appropriate antibiotics.

  • Cool cultures to 16-20°C before induction with 0.1-0.5 mM IPTG.

  • Continue expression for 16-18 hours at 16-20°C to maximize proper folding .

Cell Lysis and Fractionation:

  • Harvest cells by centrifugation (5,000 × g, 10 minutes, 4°C).

  • Resuspend in lysis buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, protease inhibitors).

  • Lyse cells by sonication or French press.

  • Centrifuge at 10,000 × g for 20 minutes to separate soluble and insoluble fractions .

  • Recover both fractions as DGAT2 distributes between them.

Purification from Soluble Fraction:

  • Apply soluble fraction to amylose resin pre-equilibrated with column buffer (lysis buffer without protease inhibitors) .

  • Wash with 10 column volumes of column buffer.

  • Elute with column buffer containing 10 mM maltose.

  • Apply eluate to Ni-NTA resin pre-equilibrated with His binding buffer (50 mM Tris-HCl pH 7.5, 300 mM NaCl, 20 mM imidazole) .

  • Wash with His binding buffer containing 50 mM imidazole.

  • Elute with His binding buffer containing 250 mM imidazole.

  • Pool fractions containing DGAT2 and perform size exclusion chromatography using Superdex 200 in a buffer compatible with downstream applications .

Purification from Insoluble Fraction:

  • Wash inclusion bodies with buffer containing 0.5% Triton X-100 to remove membrane fragments.

  • Solubilize using buffer containing 0.5-1% SDS (most effective) or other detergents .

  • Apply to Ni-NTA resin under denaturing conditions.

  • Perform on-column refolding by gradually reducing denaturant concentration.

  • Elute and proceed with size exclusion chromatography.

Verification:

  • Analyze purity by SDS-PAGE and immunoblotting using anti-MBP and anti-His antibodies .

  • Confirm identity by mass spectrometry.

  • Assess activity using in vitro DGAT assays measuring the incorporation of labeled acyl-CoA into diacylglycerol.

This protocol addresses the challenges associated with DGAT2 purification while maximizing the yield of active protein.

How can I develop a reliable assay for measuring Xenopus tropicalis DGAT2 activity in vitro?

Developing a reliable in vitro assay for X. tropicalis DGAT2 activity requires careful consideration of the enzyme's membrane association and substrate preferences. The following comprehensive assay protocol addresses these challenges:

Assay Components:

  • Purified recombinant X. tropicalis DGAT2 (from either soluble or solubilized membrane fractions)

  • Substrate mixture containing:

    • sn-1,2-diacylglycerol (DAG) substrate (typically 50-200 μM)

    • [14C]acyl-CoA or [3H]acyl-CoA (typically 10-50 μM)

    • Phospholipids (e.g., phosphatidylcholine) to form mixed micelles (0.2-1 mM)

  • Reaction buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM MgCl2)

  • MgCl2 (5-10 mM) as a cofactor

Assay Protocol:

  • Prepare substrate mixture by drying lipids under nitrogen and resuspending in reaction buffer with mild sonication to form micelles.

  • Combine substrate mixture with enzyme preparation (5-20 μg purified protein).

  • Incubate reaction at 25-30°C for 10-30 minutes.

  • Stop reaction by adding chloroform:methanol (2:1, v/v).

  • Extract lipids using Bligh and Dyer method.

  • Separate lipid classes by thin-layer chromatography using hexane:diethyl ether:acetic acid (80:20:1, v/v/v) as the mobile phase.

  • Visualize and quantify radiolabeled triacylglycerol using a phosphorimager or by scraping the TAG spot and measuring radioactivity by scintillation counting.

Assay Validation and Controls:

  • Include negative controls (heat-inactivated enzyme, no enzyme, no DAG substrate).

  • Include positive controls (mammalian DGAT2 with known activity).

  • Perform enzyme concentration and time-course experiments to ensure linearity.

  • Determine kinetic parameters (Km, Vmax) for different acyl-CoA and DAG substrates.

  • Test inhibition with known DGAT inhibitors (e.g., diacylglycerol acyltransferase inhibitors) to confirm specificity.

Optimizations for X. tropicalis DGAT2:

  • Test various detergents (0.01-0.1% Triton X-100, CHAPS, or NP-40) to optimize enzyme activity while maintaining micelle structure.

  • Evaluate temperature optima specific to X. tropicalis physiology (typically lower than mammalian enzymes).

  • Assess preferences for different acyl-CoA chain lengths and saturations, as X. tropicalis may have distinct substrate preferences compared to mammalian DGAT2.

  • Consider incorporating the enzyme into liposomes or nanodiscs to provide a more native-like membrane environment.

This assay can be adapted for high-throughput screening by miniaturization and using fluorescent acyl-CoA analogs, enabling more rapid analysis of DGAT2 activity under various conditions or in the presence of potential inhibitors.

What techniques can be used to study the subcellular localization of DGAT2 in Xenopus tropicalis embryos?

Multiple complementary techniques can be employed to study the subcellular localization of DGAT2 in Xenopus tropicalis embryos, each offering distinct advantages:

Fluorescent Protein Fusion Approaches:

  • Transgenic expression: Generate transgenic X. tropicalis lines expressing DGAT2-GFP or DGAT2-mCherry fusion proteins under endogenous or tissue-specific promoters . This allows direct visualization in living embryos through development.

  • mRNA microinjection: Inject mRNA encoding DGAT2-fluorescent protein fusions into early embryos for transient expression . This approach is faster than creating transgenic lines but may yield higher-than-physiological expression levels.

  • Confocal microscopy: Image labeled embryos using confocal microscopy to achieve high-resolution 3D visualization of DGAT2 localization relative to cellular structures.

  • Co-localization studies: Co-express markers for specific organelles (ER, Golgi, lipid droplets) to precisely determine DGAT2 subcellular distribution through development.

Immunohistochemistry Approaches:

  • Antibody generation: Develop antibodies specific to X. tropicalis DGAT2 or use anti-tag antibodies if working with tagged proteins .

  • Fixation optimization: Test multiple fixation protocols (paraformaldehyde, methanol) to preserve membrane structures while maintaining DGAT2 antigenicity.

  • Section immunostaining: Prepare cryosections or paraffin sections of embryos at different developmental stages and perform immunostaining to visualize endogenous DGAT2.

  • Whole-mount immunohistochemistry: For earlier stage embryos, whole-mount immunostaining can provide a comprehensive view of DGAT2 distribution.

Biochemical Fractionation Approaches:

  • Subcellular fractionation: Homogenize embryos and separate organelles through differential centrifugation to isolate membrane fractions containing DGAT2 .

  • Western blotting: Analyze fractions by immunoblotting to quantitatively determine DGAT2 distribution among cellular compartments.

  • Protease protection assays: Determine the membrane topology of DGAT2 by treating microsomes with proteases in the presence or absence of detergents.

  • Density gradient analysis: Further separate membranes using sucrose or iodixanol gradients to distinguish between different endomembrane compartments containing DGAT2.

Advanced Imaging Techniques:

  • FRAP (Fluorescence Recovery After Photobleaching): Assess DGAT2 mobility within membranes by photobleaching a region and measuring fluorescence recovery rate.

  • Super-resolution microscopy: Techniques such as STORM or PALM can provide nanoscale resolution of DGAT2 localization beyond the diffraction limit.

  • Correlative light and electron microscopy: Combine fluorescence imaging with electron microscopy to correlate DGAT2 localization with ultrastructural features.

  • Live imaging: Track DGAT2 localization changes during developmental processes or in response to metabolic challenges in real-time.

By combining these approaches, researchers can build a comprehensive understanding of DGAT2 dynamics during X. tropicalis development and in response to various physiological conditions or experimental manipulations.

How can I generate and characterize DGAT2 knockout lines in Xenopus tropicalis?

Generating and thoroughly characterizing DGAT2 knockout lines in Xenopus tropicalis requires a systematic approach spanning multiple generations, with careful attention to molecular, biochemical, and phenotypic analyses:

Generation of DGAT2 Knockout Lines:

  • CRISPR/Cas9 design and delivery:

    • Design multiple guide RNAs targeting conserved regions of DGAT2, particularly the active site .

    • Prepare Cas9 protein and guide RNA complex (ribonucleoprotein approach).

    • Microinject into one-cell stage X. tropicalis embryos .

    • Include tracer dye (e.g., rhodamine dextran) to confirm successful injection.

  • F0 founder identification:

    • Collect tissue samples from injected embryos that survive to swimming tadpole stage.

    • Extract genomic DNA and amplify the DGAT2 target region by PCR.

    • Screen for mutations using T7 endonuclease assay, high-resolution melting analysis, or direct sequencing .

    • Identify founders with frameshift mutations that likely result in null alleles.

  • Establishing stable lines:

    • Raise F0 founders to sexual maturity (4-6 months) .

    • Outcross to wild-type animals to generate F1 heterozygotes.

    • Genotype F1 offspring to identify those carrying the desired mutation.

    • Intercross F1 heterozygotes to generate F2 homozygous mutants .

Molecular Characterization:

  • Mutation verification:

    • Sequence the mutant allele to confirm exact nature of the mutation.

    • Design genotyping assays (restriction fragment length polymorphism, allele-specific PCR) for routine screening.

  • Transcript analysis:

    • Perform RT-PCR and qRT-PCR to assess DGAT2 mRNA levels and potential nonsense-mediated decay.

    • Check for compensatory upregulation of related genes (DGAT1, MOGAT family) by qRT-PCR.

    • Conduct RNA-seq on relevant tissues to identify broader transcriptional changes.

  • Protein analysis:

    • Confirm absence of DGAT2 protein by Western blotting using validated antibodies .

    • Assess levels of other proteins in the TAG synthesis pathway.

Biochemical Characterization:

  • Enzymatic activity:

    • Measure DGAT activity in tissue homogenates or microsomes using the in vitro assay described earlier.

    • Compare activities between wild-type, heterozygous, and homozygous mutant samples.

  • Lipid profiling:

    • Perform comprehensive lipidomics analysis using mass spectrometry to quantify changes in:

      • Triacylglycerol content and composition

      • Diacylglycerol accumulation

      • Phospholipid profiles

      • Free fatty acid levels

  • Metabolic labeling:

    • Conduct pulse-chase experiments with labeled fatty acids to track alterations in lipid metabolism dynamics.

Phenotypic Characterization:

  • Developmental assessment:

    • Document embryonic development through time-lapse imaging.

    • Assess growth rates, time to reach key developmental stages, and survival curves.

    • Examine tissue-specific development, particularly in tissues with high lipid requirements.

  • Histological analysis:

    • Perform Oil Red O staining to visualize neutral lipid distribution.

    • Conduct electron microscopy to examine lipid droplet formation and structure.

    • Analyze tissue architecture, particularly in liver and adipose tissues.

  • Functional testing:

    • Challenge mutants with different diets (high-fat, high-carbohydrate) to assess metabolic flexibility.

    • Perform starvation tests to examine mobilization of energy reserves.

    • Assess response to temperature changes, as DGAT2 activity may impact cold tolerance.

  • Rescue experiments:

    • Inject wild-type DGAT2 mRNA into early embryos to confirm phenotype specificity.

    • Generate tissue-specific rescue lines using transgenic approaches to identify critical tissues .

This comprehensive characterization approach will provide definitive insights into DGAT2 function in X. tropicalis and create a valuable resource for comparative studies with DGAT2 function in other organisms.

How does Xenopus tropicalis DGAT2 structure and function compare to mammalian DGAT2 orthologs?

Xenopus tropicalis DGAT2 shares significant structural and functional features with mammalian DGAT2 orthologs, but also exhibits important differences that reflect evolutionary adaptation and species-specific metabolic requirements:

Structural Comparisons:

Functional Comparisons:

  • Substrate preferences: X. tropicalis DGAT2 may show greater activity with medium-chain fatty acyl-CoAs compared to mammalian DGAT2, potentially reflecting differences in dietary fatty acid composition or temperature adaptation in amphibians.

  • Temperature optima: X. tropicalis DGAT2 likely exhibits maximal activity at lower temperatures (20-25°C) compared to mammalian enzymes (37°C), consistent with the poikilothermic nature of amphibians.

  • Developmental expression: While both mammalian and X. tropicalis DGAT2 are expressed during embryonic development, the temporal pattern differs, with X. tropicalis showing earlier relative expression that correlates with the rapid early development of amphibian embryos.

  • Tissue distribution: X. tropicalis DGAT2 shows highest expression in liver, intestine, and developing oocytes, generally similar to the pattern in mammals but with relatively higher expression in reproductive tissues, reflecting the large lipid stores required for egg production.

  • Metabolic regulation: The regulation of X. tropicalis DGAT2 by hormones and nutritional status shows both conserved features (insulin responsiveness) and divergent mechanisms adapted to amphibian physiology and life cycle.

These comparative insights are valuable for understanding the fundamental conserved functions of DGAT2 in vertebrate lipid metabolism versus adaptations specific to different vertebrate lineages. They also inform the appropriate interpretation of X. tropicalis as a model for human DGAT2-related metabolic processes.

What insights can Xenopus tropicalis DGAT2 research provide for understanding human metabolic disorders?

Research on Xenopus tropicalis DGAT2 offers valuable insights into human metabolic disorders through several mechanisms, creating translational relevance for this amphibian model:

Fundamental Mechanisms of Lipid Metabolism:

Disease Modeling Applications:

  • Non-alcoholic fatty liver disease (NAFLD): By manipulating DGAT2 expression or activity in X. tropicalis, researchers can model aspects of NAFLD pathogenesis, particularly the role of hepatic TAG accumulation in disease progression. The transparent nature of X. tropicalis tadpoles facilitates visualization of lipid accumulation in vivo.

  • Insulin resistance: Studies in X. tropicalis can elucidate how altered DGAT2 activity affects insulin sensitivity across tissues, providing insights into the mechanistic links between lipid metabolism and glucose homeostasis that are central to type 2 diabetes.

  • Obesity pathophysiology: X. tropicalis DGAT2 mutants or transgenics can help clarify whether increased or decreased DGAT2 activity is beneficial or detrimental in the context of caloric excess, addressing the paradox that both DGAT2 inhibition and overexpression have been proposed as anti-obesity strategies.

Therapeutic Discovery Applications:

  • Inhibitor development: The ability to express recombinant X. tropicalis DGAT2 and develop in vitro activity assays provides a platform for screening potential DGAT2 inhibitors . Comparative studies with human DGAT2 can identify compounds with conserved inhibitory activity across species.

  • Toxicity assessment: X. tropicalis embryos and tadpoles serve as an efficient system for evaluating potential off-target effects or developmental toxicities of DGAT2-targeting therapeutics . Their rapid development and optical transparency make them particularly valuable for this application.

  • Combination therapy insights: By simultaneously manipulating DGAT2 and other metabolic enzymes in X. tropicalis, researchers can identify synergistic or antagonistic interactions that inform combination therapy approaches for complex metabolic disorders in humans.

The translational value of X. tropicalis DGAT2 research is enhanced by the animal's unique combination of experimental advantages: the ability to produce large numbers of externally developing embryos, amenability to genetic manipulation, and sufficient evolutionary conservation with humans to maintain relevance for human disease processes .

What are the key challenges and future directions in Xenopus tropicalis DGAT2 research?

Research on Xenopus tropicalis DGAT2 has made significant progress but faces several important challenges that define future research directions. Addressing these challenges will enhance our understanding of lipid metabolism in vertebrates and potentially lead to new therapeutic strategies for metabolic disorders.

Current Technical Challenges:

  • Protein purification limitations: Despite advances in expression systems, obtaining sufficient quantities of purified, active X. tropicalis DGAT2 remains difficult due to its hydrophobic nature and tendency to form oligomeric complexes . New approaches using nanodiscs or improved detergent systems are needed to better stabilize the purified protein.

  • Structural characterization: The membrane-associated nature of DGAT2 has hampered high-resolution structural studies. No crystal or cryo-EM structure exists for any DGAT2 ortholog, creating a significant knowledge gap in understanding its catalytic mechanism and regulation .

  • Tissue-specific knockout models: While germline DGAT2 mutations are now feasible in X. tropicalis, developing efficient methods for tissue-specific and inducible gene deletion would enable more nuanced studies of DGAT2 function in specific contexts without developmental confounders .

  • Quantitative imaging of lipid metabolism: Current methods for visualizing TAG synthesis and lipid droplet formation in vivo in X. tropicalis have limited spatial and temporal resolution. Developing improved biosensors and imaging approaches would enhance studies of dynamic DGAT2 activity.

Emerging Research Directions:

  • Integrative multi-omics approaches: Combining DGAT2 manipulation with comprehensive lipidomic, proteomic, and transcriptomic analyses in X. tropicalis will provide systems-level insights into how alterations in TAG synthesis affect broader metabolic networks and developmental processes.

  • Evolutionary adaptations in DGAT2 function: Comparative studies between X. tropicalis, X. laevis, and other vertebrates can elucidate how DGAT2 function has adapted to different environmental niches and metabolic demands through evolution .

  • Environmental influences on DGAT2 regulation: Investigating how environmental factors (temperature, nutrition, toxins) modulate DGAT2 expression and activity in X. tropicalis will enhance our understanding of gene-environment interactions in metabolic regulation.

  • DGAT2 interactome characterization: Identifying and validating protein-protein interactions involving DGAT2 in X. tropicalis will clarify how this enzyme functions within larger complexes to coordinate TAG synthesis with other lipid metabolic pathways .

  • Non-canonical functions of DGAT2: Exploring potential roles of DGAT2 beyond TAG synthesis, such as in signaling pathways or membrane remodeling, may reveal unexpected functions relevant to development and disease.

By addressing these challenges and pursuing these research directions, the X. tropicalis model system will continue to provide valuable insights into DGAT2 biology with potential translational implications for human metabolic health. The combination of genetic tractability, experimental accessibility, and evolutionary conservation makes X. tropicalis particularly well-suited for these investigations .

What collaborative approaches could accelerate Xenopus tropicalis DGAT2 research?

Accelerating research on Xenopus tropicalis DGAT2 would benefit significantly from strategic collaborative approaches that leverage complementary expertise and resources. Several structured collaborative frameworks could particularly enhance progress in this field:

Cross-disciplinary Research Consortia:

  • Metabolic engineering and biochemistry collaboration: Partnerships between X. tropicalis developmental biologists and lipid biochemists would enhance the characterization of DGAT2 enzymatic properties and regulation . Such collaborations could apply advanced lipidomic techniques to developmental contexts, linking molecular mechanisms to phenotypic outcomes.

  • Structural biology partnerships: Collaborations with membrane protein structural biology experts could overcome the challenges of DGAT2 structural determination . Combined approaches using X-ray crystallography, cryo-EM, and computational modeling might finally reveal the three-dimensional structure of DGAT2, a longstanding goal in the field.

  • Bioinformatics and comparative genomics integration: Collaborative analysis of DGAT2 across vertebrate lineages could identify conserved regulatory elements and species-specific adaptations, providing evolutionary context for X. tropicalis findings .

Technology Development Initiatives:

  • CRISPR optimization consortium: A coordinated effort to develop and standardize improved CRISPR/Cas9 methods specifically optimized for X. tropicalis would benefit the entire research community while enabling more precise DGAT2 manipulations .

  • Imaging technology adaptation: Collaborations between X. tropicalis researchers and advanced microscopy developers could create specialized techniques for visualizing lipid metabolism in real-time during amphibian development.

  • Transgenic line repository: Establishing a centralized resource for sharing well-characterized X. tropicalis transgenic and mutant lines related to lipid metabolism, including DGAT2 variants, would accelerate research by reducing duplication of effort .

Translational Research Networks:

  • Xenopus-human disease modeling collaborative: Formal partnerships between X. tropicalis researchers and clinical investigators studying human metabolic disorders could strengthen the translational relevance of findings and identify the most promising therapeutic targets.

  • Pharmaceutical industry partnerships: Collaborations with industry partners interested in DGAT2 inhibitor development could provide resources for high-throughput screening and lead optimization while offering academic researchers insights into drug development challenges .

  • Toxicology testing networks: Xenopus embryos are well-suited for toxicology studies, and collaborative networks using standardized protocols to assess how environmental chemicals affect DGAT2 function could have both basic science and public health implications .

Resource and Knowledge Sharing Platforms:

  • Xenopus DGAT2 database: A dedicated database integrating genomic, transcriptomic, proteomic, and phenotypic data related to DGAT2 in X. tropicalis would facilitate data mining and hypothesis generation.

  • Methodological standardization initiative: Developing consensus protocols for assessing DGAT2 expression, localization, and activity in X. tropicalis would enhance data reproducibility and facilitate meta-analyses across studies .

  • Regular focused workshops: Organizing specialized workshops bringing together researchers studying DGAT2 across different model systems would stimulate new collaborative projects and methodology sharing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.