Recombinant Xenopus tropicalis DnaJ homolog subfamily B member 14 (dnajb14)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dnajb14; TEgg043m09.1; DnaJ homolog subfamily B member 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-375
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
dnajb14
Target Protein Sequence
MESNRDEAERCVRIAKAAIEAGDKEKAKRFLSKAERLYPSSEARALLQAFEKNDTAGNGP
QSAKMAKGTEQPKAEKDSNASASSDTGKGHTQDQLDGVQRIKKCKTYYEVLGVSTDAGEE
DLKKAYRKLALKFHPDKNHAPGATEAFKKIGNAYAVLSNPEKRKQYDLTGSEDQMQNNHR
NGGFDYHRGFEADITPEDLFNMFFGGGFPSGSVHTFSNGRARYSHHQHHHHSGHDREDER
ADGGFSMFIQLMPIIVLILVSLLSQFMVSNPPYSLYPRSGQATKRVTENLQIAYYVSKDF
QSEYSGILLQKLEKNIEEDYVANVRNNCWRERQQRSDLMHAAKVYRDERLKVKAESISME
NCKELNRLTSLFRGG
Uniprot No.
Target Background
Function
This protein functions as a co-chaperone with HSPA8/Hsc70, essential for protein folding and trafficking. It prevents client protein aggregation and directs misfolded proteins to the endoplasmic reticulum-associated degradation (ERAD) pathway. Its mechanism involves modulating HSPA8/Hsc70's ATPase and polypeptide-binding activities. Independently of HSPA8/Hsc70, it can also function with DNAJB12 as a chaperone promoting potassium channel maturation. This involves stabilizing nascent channel subunits and assembling them into tetramers. While HSPA8/Hsc70 is required for nascent channel protein stabilization, channel subunit oligomerization is independent of HSPA8/Hsc70.
Database Links
Protein Families
DnaJ family, DNAJB12/DNAJB14 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
