Recombinant Xenopus tropicalis DnaJ homolog subfamily C member 22 (dnajc22)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant X. tropicalis DNAJC22 is commercially available in multiple expression systems:

Expression SystemTagPuritySource
E. coliHis, GST, or Fc>90%Creative BioMart
HEK293 cellsAvi or native>95%Creative BioMart
Wheat germNon-tagged>85%Anagnostics

Key production details:

  • The protein is stored in Tris-based buffer with 50% glycerol at -20°C, with a recommended working aliquot storage at 4°C for ≤1 week .

  • Avoid repeated freeze-thaw cycles to maintain stability .

Research Applications

Model organism utility:

  • X. tropicalis is a diploid frog species with strong genomic synteny to mammals, making it ideal for studying conserved developmental processes .

  • Recombinant DNAJC22 enables loss-of-function studies via CRISPR or morpholino knockdown to explore roles in embryogenesis and cellular homeostasis .

Technical advantages:

  • Compatibility with X. laevis assays allows cross-species validation of chaperone mechanisms .

  • High-yield production in E. coli supports structural studies (e.g., crystallography) .

Future Directions

  • Functional mapping: Resolve substrate-binding specificity using mutagenesis screens.

  • Developmental roles: Characterize DNAJC22’s contribution to early embryogenesis via X. tropicalis mutant models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preferences in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
dnajc22; DnaJ homolog subfamily C member 22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
dnajc22
Target Protein Sequence
MGKSLLAAYGLWALGGPLGLYHIYLGRDSHALLWMLTLGGFGMGWMWDFWKIPIHVYKYN RQERKNIEVKEGEPPASPIRFIGQVATGIYFGIVAAIGLSFLSSFHMVVLPLAVALGVHL VATVGEQTSDLKNTLIAAFLTSPIFYGRAVSMIPISLTASITSQKHMRYRLQQEKQEKLS LRLYRIGLVYLAFTGPLAYSALLNTSLTVSYVAGSIGSMLEWLSIFPSISALVERLLLLP YRVWAVFSGGGVFRDHYFKEWEKIYEFVATFQSEKEEMACKVLGVNFKSTMEEINRKYRE LVKIWHPDHNRHRLEEAQEHFLEIQAAYETLMRLRKSKTL
Uniprot No.

Target Background

Function
This protein may function as a co-chaperone.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the biological function of dnajc22 in Xenopus tropicalis?

Dnajc22 functions as a molecular chaperone belonging to the DnaJ (Hsp40) superfamily. Current evidence suggests it may function as a co-chaperone in protein quality control pathways . Like other DnaJ proteins, it likely assists Hsp70 chaperones in protein folding, preventing aggregation, and facilitating protein transport across cellular compartments. The protein contains characteristic domains that enable these functions, including the conserved J-domain that mediates interaction with Hsp70 proteins.

What tissues express dnajc22 in Xenopus tropicalis?

Expression data from Xenbase indicates that dnajc22 is primarily expressed in intestine and liver tissues, as well as being detected in whole organism analyses . This expression pattern suggests potential roles in digestive system functions, protein quality control during development, and possibly tissue-specific stress responses. RNA-Seq data from Session et al. 2016 provides developmental stage-specific expression profiles for both X. tropicalis and X. laevis (L and S forms) .

What are the optimal conditions for expressing and purifying recombinant Xenopus tropicalis dnajc22?

For recombinant expression:

  • Expression System: E. coli has been successfully used for expressing full-length Xenopus tropicalis dnajc22 (1-340aa)

  • Tagging: N-terminal His tag facilitates purification via affinity chromatography

  • Buffer Composition: After purification, the protein can be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Reconstitution Protocol: Centrifuge the lyophilized protein vial briefly before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Long-term Storage: Add glycerol to a final concentration of 5-50% and store aliquots at -20°C/-80°C

  • Quality Control: Purity greater than 90% can be achieved as determined by SDS-PAGE

How can researchers manipulate dnajc22 expression in Xenopus embryos for functional studies?

Several approaches are available for manipulating gene expression in Xenopus:

  • Morpholino-based knockdown:

    • Design morpholino oligonucleotides (MOs) targeting either the translation start site or splice junctions of dnajc22

    • Resuspend MOs in sterile water (not DEPC-treated) at a concentration of approximately 1mM

    • Prior to use, heat aliquots at 65°C for 10 minutes and vortex to ensure complete dissolution

    • Microinject into fertilized eggs or specific blastomeres depending on experimental design

    • Verify knockdown efficiency using Western blotting or immunohistochemistry

  • mRNA overexpression:

    • Synthesize capped dnajc22 mRNA using in vitro transcription

    • Inject mRNA into fertilized Xenopus eggs for global overexpression

    • For region-specific studies, inject into selected blastomeres (e.g., one cell of a two-cell embryo for one-sided overexpression)

    • This approach is particularly useful for studying early developmental effects

  • CRISPR-Cas9 genome editing:

    • Design guide RNAs targeting the 5' portion of the dnajc22 coding region

    • Generate F0 mosaic individuals and cross with wildtypes to produce non-mosaic F1 offspring

    • Intercross F1 individuals to generate homozygous null and heterozygous F2 animals

    • Confirm genotypes by DNA extraction and Sanger sequencing

What are the structural features of dnajc22 protein?

While detailed three-dimensional structural information is not available in the provided search results, as a member of the DnaJ family, dnajc22 likely contains:

  • J-domain: The defining feature of DnaJ proteins, responsible for stimulating Hsp70 ATPase activity

  • Membrane-associated regions: Analysis of the sequence suggests transmembrane domains, consistent with its presence in specific tissues like liver and intestine

  • Substrate binding domains: Likely present for interaction with client proteins

The amino acid composition suggests a protein with both hydrophobic and hydrophilic regions, consistent with membrane association and chaperone functions .

What proteins interact with dnajc22 in Xenopus?

STRING database analysis reveals several potential interaction partners:

ProteinInteraction ScoreFunction
dnajb14-20.779J domain-containing protein
Sgta.L0.911TPR_REGION domain-containing protein
dnajc280.815J domain-containing protein
Hsph1.S0.740Heat shock protein
dnajc190.722J domain-containing protein
hspa90.714Heat shock protein 70 family
Hspa9.L0.713Heat shock protein 70 family
dnajc20.710J domain-containing protein
hspa50.706Heat shock protein 70 family

These interactions suggest dnajc22 functions within a larger chaperone network, potentially collaborating with other DnaJ proteins and various heat shock proteins to maintain proteostasis .

How can recombinant dnajc22 be utilized in biochemical and functional assays?

Recombinant dnajc22 can be employed in multiple research applications:

  • Chaperone activity assays:

    • ATPase stimulation assays to measure activation of partner Hsp70 proteins

    • Protein aggregation prevention assays using model substrates prone to misfolding

    • Protein refolding assays with denatured luciferase or other reporter proteins

  • Binding partner identification:

    • Co-immunoprecipitation experiments using the His-tagged protein as bait

    • Pull-down assays followed by mass spectrometry to identify novel interactors

    • Yeast two-hybrid screening to identify direct protein-protein interactions

  • Structural studies:

    • Circular dichroism spectroscopy to assess secondary structure composition

    • Limited proteolysis to identify domain boundaries and flexible regions

    • X-ray crystallography or cryo-EM approaches (following optimization of protein stability)

What methodological considerations are important when designing experiments involving dnajc22 in Xenopus embryonic development?

When studying dnajc22 in Xenopus development, researchers should consider:

  • Timing of manipulation:

    • dnajc22 expression may vary throughout development, requiring stage-specific interventions

    • RNA-Seq data from Session et al. 2016 can guide determination of critical developmental periods

  • Xenopus model selection:

    • X. laevis offers larger embryos advantageous for microinjection and biochemical analyses

    • X. tropicalis provides benefits of a diploid genome and shorter generation time for genetic studies

  • Experimental controls:

    • For morpholino studies, include control morpholinos and rescue experiments with morpholino-resistant mRNA

    • For CRISPR-Cas9 editing, analyze multiple founder lines and F1 offspring to control for off-target effects

  • Animal cap explants:

    • Can be used to study dnajc22 in a simplified context

    • Allow analysis of gene expression changes in response to specific signaling molecules

How is dnajc22 conserved across species?

Dnajc22 appears to be conserved across vertebrate species, including:

  • Xenopus tropicalis (Western clawed frog)

  • Rattus norvegicus (Norway rat) - listed as gene ID 362998

Comparative analysis would likely reveal conservation of key functional domains, particularly the J-domain characteristic of this protein family. Differences in sequence may reflect species-specific adaptations and functional specializations. Evolutionary conservation suggests important biological functions maintained under selective pressure.

What can cross-species comparisons tell us about dnajc22 function?

Cross-species functional studies can reveal:

  • Conservation of biochemical activities across evolutionary distance

  • Species-specific adaptations in chaperone networks

  • Divergent or convergent roles in tissue development and maintenance

Xenopus provides an excellent model for such comparisons due to its position in vertebrate evolution and the extensive toolkit available for manipulating gene function .

What are the optimal storage and handling conditions for recombinant dnajc22?

For maximum stability and activity:

  • Long-term storage:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • After reconstitution, add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot to minimize freeze-thaw cycles and store at -20°C/-80°C

  • Working solutions:

    • Working aliquots can be maintained at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

  • Reconstitution procedure:

    • Briefly centrifuge vial before opening to collect all material

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Ensure complete dissolution before experimental use

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.