Recombinant Xenopus tropicalis DnaJ homolog subfamily C member 25 (dnajc25)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your consideration.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If a particular tag is required, please specify this in your order; we will prioritize your request.
Synonyms
dnajc25; DnaJ homolog subfamily C member 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-368
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
dnajc25
Target Protein Sequence
MAALGKAEESQGCFGLFLLLPGPSMQPRLFVLVALSVLLLSGRAGALTEGLYCGRQVCYD VLGVSRDASKGDIARAYRQLARKYHPDRYRPGEPPGPDGETRESAQEKFLLVATAYETLK DEETRKDYDYMLDHPEEYYRHYYHYYSRRLAPKVDVRIVILVSVCAISIFQYYSWWSSYN EAINYLATVTKYRIQAMEIAKQQGLLNRTKEKGKNRRSKEEIKSEEEEIIRDIIKNKIDI KGGYQKPQIFDILLFQIILFPYYIFKYISWYVHWIYTFNIQGKEYGEEEKLYLIRRNMKM SQSQFDTLEEHRKNSFLEQKLWIKENYEVYKLEQEEEMKKKMASDPRWKRYRRWMKNEGP GRLTFADD
Uniprot No.

Target Background

Database Links

KEGG: xtr:496999

UniGene: Str.17134

Protein Families
DNAJC25 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is DNAJC25 and what are its fundamental functions in cellular processes?

DNAJC25 is a member of the DnaJ/HSP40 subfamily C of heat shock proteins. These proteins function as co-chaperones by binding to Hsp70 through their J domain and stimulating ATP hydrolysis. This activity aids in multiple cellular processes including protein translation, folding, unfolding, translocation, and degradation . The protein has been localized to the cytoplasm and contains characteristic structural domains that facilitate its chaperone function. DNAJC25 has been implicated in various cellular processes, particularly those related to maintaining protein homeostasis under normal and stress conditions. Understanding its basic function provides foundational knowledge for interpreting its role in disease states and developmental processes.

How is DNAJC25 expression distributed across different tissues, and what does this suggest about its physiological roles?

Research has demonstrated that DNAJC25 exhibits tissue-specific expression patterns. RT-PCR analyses across 15 human tissues revealed that DNAJC25 has remarkably high expression in liver tissue, with considerably lower levels detected in the thymus, prostate, testis, ovary, small intestine, and colon . Notably, no amplification products were visualized in the heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, or spleen.

This distinctive expression pattern, with predominance in liver tissue, strongly suggests that DNAJC25 may have specialized functions in hepatic physiology. The tissue distribution data provides valuable direction for researchers investigating the protein's role in organ-specific functions and pathologies, particularly liver-related conditions.

What experimental approaches are suitable for studying DNAJC25 in Xenopus tropicalis as a model organism?

Xenopus tropicalis serves as an excellent model organism for studying DNAJC25 due to its diploid genome (unlike the tetraploid X. laevis) and strong synteny with amniote genomes . When designing experiments, researchers should consider:

  • Embryological techniques: X. tropicalis offers robust embryological, molecular, and biochemical assays that can be readily transferred from techniques established for X. laevis .

  • Genetic manipulations: Methods include haploid genetics, gynogenesis, and androgenesis. For haploid embryo production, researchers should prime adult females with HCG, collect eggs, and utilize UV irradiation techniques as specified in established protocols .

  • Transgenic approaches: Transgenic rescue of mutant backgrounds with floxed constructs provides methods for conditional allele creation to delete gene functions in specific tissues or developmental timepoints .

  • High-throughput sequencing: This can be combined with solution-hybridization whole-exome enrichment technology for cloning novel mutations or reverse genetic identification of specific gene sequence lesions .

These approaches capitalize on X. tropicalis advantages, including the large number of embryos/meioses produced and the ease of haploid genetics, making it particularly suitable for DNAJC25 functional studies.

What is the relationship between DNAJC25 expression and hepatocellular carcinoma, and what methodologies best examine this correlation?

DNAJC25 has been identified as significantly downregulated in hepatocellular carcinoma (HCC) compared to adjacent normal tissues, suggesting a potential tumor suppressor role. Quantitative analysis of 87 pairs of HCC specimens and corresponding non-tumorous specimens revealed that DNAJC25 was downregulated in 50 HCC specimens (57.5%; >2-fold decrease), normally expressed in 26 tumors (29.9%), and overexpressed in only 11 tumors (12.6%; >2-fold increase) with statistical significance (P<0.001) .

DNAJC25 Expression in HCCNumber of SpecimensPercentage
Downregulated (>2-fold)5057.5%
Normally expressed2629.9%
Overexpressed (>2-fold)1112.6%

To examine this correlation, researchers should employ:

  • Quantitative real-time PCR with appropriate endogenous controls (e.g., β2-MG gene transcripts) for accurate quantification of expression differences between tumor and non-tumor tissues .

  • Colony formation assays to assess the functional impact of DNAJC25 expression levels on cancer cell growth and proliferation.

  • Flow cytometry analysis to evaluate effects on apoptosis and cell cycle progression .

  • Immunohistochemistry to visualize protein expression patterns within tissue architecture.

  • Correlation analyses between expression levels and clinical parameters (tumor stage, patient survival, etc.) to establish clinical relevance.

These approaches collectively provide comprehensive insights into DNAJC25's role in hepatocarcinogenesis and its potential as a tumor suppressor candidate.

How can overexpression models of DNAJC25 be established, and what cellular effects have been observed in such systems?

Establishing effective DNAJC25 overexpression models requires careful consideration of expression vectors, cell lines, and analytical methods. Based on research findings, the following approach has proven effective:

  • Vector construction: Utilize mammalian expression vectors like pcDNA3.1A(-) or pCMV-Myc with full-length DNAJC25 cDNA inserts .

  • Cell line selection: HCC cell lines (Hep3B, SMMC-7721) have demonstrated successful transfection and phenotypic effects. HEK 293 cells can serve as a non-hepatic comparison with typically higher transfection efficiency .

  • Transfection protocol: Optimize transfection conditions based on cell type; lipid-based transfection methods are commonly employed.

  • Expression verification: Confirm expression using Western blotting with appropriate antibodies against DNAJC25 or vector tags (Myc-tag).

Observed cellular effects in such overexpression systems include:

  • Colony formation inhibition: Overexpression of DNAJC25 resulted in a 74.67% reduction in colony formation for Hep3B cells (P<0.001) and 79.00% reduction for SMMC-7721 cells (P<0.05) .

  • Reduced colony size: Colonies formed by cells transfected with DNAJC25 were significantly smaller than those formed by control vector-transfected cells .

  • Increased apoptosis: Flow cytometry analysis revealed a significant sub-G1 peak indicating increased apoptotic cell population. The sub-G1 ratio was 18.80% in Hep3B cells transfected with DNAJC25 compared to 13.23% in control cells (P<0.001) .

  • Similar apoptotic effects in non-hepatic cells: HEK 293 cells showed a sub-G1 ratio of 16.41% when transfected with DNAJC25 versus 3.92% in control cells (P<0.05) .

  • No significant cell cycle arrest: Despite increased apoptosis, no marked differences in cell cycle progression were observed .

These findings indicate that DNAJC25 primarily induces apoptosis rather than cell cycle arrest, suggesting a mechanism for its potential tumor suppressive properties.

What are the technical challenges in producing and purifying recombinant Xenopus tropicalis DNAJC25 protein for functional studies?

Production and purification of recombinant Xenopus tropicalis DNAJC25 protein presents several technical challenges that researchers must address:

How do the functions of different DnaJ homolog subfamily C members compare, and what methodologies can distinguish their specific roles?

The DnaJ homolog subfamily C contains numerous members with diverse functions despite sharing the characteristic J-domain. Comparing DNAJC25 with other members like DNAJC22 requires specialized methodological approaches:

  • Sequence and structural comparison:

    • Alignment of amino acid sequences reveals conserved domains versus unique regions

    • DNAJC22 (340 amino acids) compared to DNAJC25 (368 amino acids) shows distinct sequence features beyond the J-domain

    • 3D structural modeling can predict functional differences based on protein folding patterns

  • Expression pattern analysis:

    • Unlike the liver-specific high expression of DNAJC25, other DNAJC proteins may show different tissue distribution patterns

    • Comparing expression across developmental stages can reveal temporal differences in function

    • Single-cell RNA sequencing can identify cell-type specific expression patterns

  • Functional discrimination methods:

    • Knockout/knockdown comparison: Generate specific gene knockouts for each DNAJC member and compare phenotypes

    • Co-immunoprecipitation to identify differential binding partners

    • ATPase activity assays to measure differences in Hsp70 stimulation capacity

    • Domain-swapping experiments to determine which protein regions confer specific functions

  • Subcellular localization:

    • Immunofluorescence staining with specific antibodies

    • Fractionation studies to determine membrane association versus cytoplasmic distribution

    • DNAJC25 is primarily cytoplasmic, while other DNAJC members may have different localizations

  • Differential roles in disease models:

    • While DNAJC25 shows tumor suppressor properties in HCC, other DNAJC members may have different roles in cancer or other diseases

    • Comparative studies in disease models can highlight functional specialization

These comparative approaches help establish the specific functions of DNAJC25 within the broader context of the DNAJ/HSP40 protein family, providing insights into both redundant and unique roles.

What quality control measures should be implemented when working with recombinant Xenopus tropicalis DNAJC25?

Ensuring the quality and reliability of recombinant Xenopus tropicalis DNAJC25 protein is critical for research validity. Implement the following quality control measures:

  • Purity assessment:

    • SDS-PAGE analysis should confirm purity greater than 90%

    • Mass spectrometry to verify protein identity and detect potential contaminants

    • Endotoxin testing for preparations intended for cellular assays

  • Functional validation:

    • ATPase stimulation assay to confirm J-domain functionality

    • Thermal shift assays to assess protein stability

    • Circular dichroism to verify proper protein folding

  • Storage and handling protocols:

    • Lyophilized powder form provides superior stability for long-term storage

    • Upon reconstitution, store in deionized sterile water at a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles; maintain working aliquots at 4°C for up to one week

  • Batch consistency:

    • Maintain detailed lot records with expression and purification parameters

    • Implement comparative testing between batches to ensure consistent activity

    • Document stability under various storage conditions

  • Application-specific testing:

    • For cell-based assays, test for effects on cell viability independent of experimental variables

    • For binding studies, verify concentration-dependent interactions with known partners

    • For structural studies, confirm homogeneity by size-exclusion chromatography

Following these quality control measures ensures reliable and reproducible results when working with recombinant DNAJC25 protein.

How can researchers effectively design experiments to study the potential tumor suppressor role of DNAJC25 in different contexts?

Designing experiments to investigate DNAJC25's potential tumor suppressor role requires a multi-faceted approach:

  • Expression analysis in diverse cancer types:

    • Extend beyond HCC to examine DNAJC25 expression in multiple cancer types

    • Use paired tumor/normal samples with sufficient statistical power (n≥80 as in previous studies)

    • Employ RT-qPCR with validated reference genes for accurate quantification

    • Validate mRNA findings at the protein level with immunohistochemistry or Western blotting

  • Mechanistic investigation of apoptosis induction:

    • Annexin V/PI staining to confirm and quantify apoptosis

    • Analysis of caspase activation pathways (intrinsic vs. extrinsic)

    • Mitochondrial membrane potential measurement

    • Expression analysis of pro- and anti-apoptotic proteins following DNAJC25 overexpression

  • In vivo tumor models:

    • Xenograft models with DNAJC25-overexpressing cancer cells

    • Inducible expression systems to study temporal effects

    • Patient-derived xenografts to assess effects in more clinically relevant models

    • Measure tumor growth, invasion, and metastasis parameters

  • Interaction with known oncogenic pathways:

    • Investigate DNAJC25 effects on major cancer-related signaling pathways (Wnt/β-catenin, MAPK, PI3K/Akt)

    • Co-expression with established oncogenes to assess antagonistic effects

    • RNA-seq and proteomics to identify global changes upon DNAJC25 modulation

  • Clinical correlation studies:

    • Correlate DNAJC25 expression levels with:

      • Patient survival outcomes

      • Tumor stage and grade

      • Treatment response

      • Recurrence rates

  • Loss-of-function approaches:

    • CRISPR/Cas9-mediated knockout in normal liver cells to assess tumorigenic potential

    • shRNA knockdown in cell lines with high endogenous DNAJC25 expression

    • Dominant-negative mutant expression to disrupt endogenous function

These experimental approaches provide comprehensive evaluation of DNAJC25's tumor suppressor potential across multiple cancer contexts and mechanistic levels.

What are the considerations for using Xenopus tropicalis genetic manipulation techniques to study DNAJC25 function in development?

Xenopus tropicalis offers unique advantages for genetic manipulation studies of DNAJC25. Researchers should consider:

  • Haploid genetic approaches:

    • For producing haploid embryos, adult female X. tropicalis should be primed with 10u HCG 12-72 hours prior to the procedure, followed by boosting with 100-200u HCG

    • UV irradiation of sperm inactivates paternal DNA while maintaining fertilization capacity

    • Control groups with untreated sperm should be maintained for comparison

    • Haploid embryos can reveal recessive phenotypes in a single generation

  • Gynogenesis and androgenesis techniques:

    • Gynogenesis: Fertilize eggs with UV-irradiated sperm, then prevent first cleavage division to produce diploid embryos with only maternal genetic contribution

    • Androgenesis: Remove maternal genetic material from eggs, then fertilize with normal sperm and prevent first cleavage to produce diploid embryos with only paternal contribution

    • These approaches help dissect parent-of-origin effects on DNAJC25 function

  • CRISPR/Cas9 genome editing:

    • Design guide RNAs specific to X. tropicalis DNAJC25 sequence

    • Optimize microinjection parameters for different developmental stages

    • Screen for mutations using T7 endonuclease assay or direct sequencing

    • Establish stable transgenic lines through germline transmission

  • Morpholino knockdown:

    • Design translation-blocking or splice-blocking morpholinos specific to DNAJC25

    • Validate specificity through rescue experiments with morpholino-resistant mRNA

    • Dose-response curves to determine optimal concentration

    • Controls with mismatch morpholinos are essential

  • Transgenic approaches:

    • Use tissue-specific promoters to drive DNAJC25 expression in specific cell types

    • Employ inducible systems (e.g., Tet-On/Off) for temporal control

    • Floxed constructs with tissue-specific Cre expression for conditional deletion

    • Fluorescent reporter fusion proteins to track DNAJC25 localization in vivo

  • Developmental considerations:

    • Stage-specific expression analysis to determine when DNAJC25 functions

    • Temperature-shift experiments to study temperature-sensitive phenotypes

    • Careful documentation of developmental timing, as manipulation may cause developmental delays

These genetic approaches capitalize on X. tropicalis advantages, including diploid genome, strong synteny with amniotes, high fecundity, and external development, making it an excellent model for DNAJC25 functional studies.

What emerging technologies could enhance our understanding of DNAJC25 protein interactions and regulatory networks?

Several emerging technologies offer promising avenues for deeper investigation of DNAJC25:

  • Proximity labeling approaches:

    • BioID or APEX2 fusion proteins to identify proximal interaction partners in living cells

    • TurboID for rapid labeling of neighboring proteins with improved temporal resolution

    • This would reveal the dynamic interactome of DNAJC25 in different cellular contexts

  • Cryo-electron microscopy:

    • High-resolution structural analysis of DNAJC25 alone and in complex with Hsp70

    • Visualization of conformational changes during the chaperone cycle

    • Structure-based drug design targeting specific protein-protein interactions

  • Single-molecule techniques:

    • FRET-based approaches to study DNAJC25-substrate interactions in real-time

    • Optical tweezers to measure forces during protein folding assistance

    • These methods provide mechanistic insights into chaperone function

  • Spatial transcriptomics and proteomics:

    • Mapping DNAJC25 expression patterns with subcellular resolution

    • Correlation with client protein distribution in normal and disease states

    • Identification of tissue microenvironments where DNAJC25 function is critical

  • Organoid models:

    • Liver organoids to study DNAJC25 function in a physiologically relevant 3D context

    • Patient-derived organoids to examine effects of DNAJC25 variants in personalized models

    • Disease modeling with induced pluripotent stem cell-derived organoids

  • Systems biology approaches:

    • Integration of multi-omics data to place DNAJC25 within broader regulatory networks

    • Mathematical modeling of chaperone networks to predict system-level effects of DNAJC25 perturbation

    • Network pharmacology to identify potential therapeutic targets related to DNAJC25 dysfunction

These technologies will significantly enhance our understanding of DNAJC25's cellular functions and potential therapeutic relevance.

How might comparative studies between Xenopus tropicalis and mammalian DNAJC25 orthologs inform evolutionary conservation of function?

Comparative studies between Xenopus tropicalis and mammalian DNAJC25 orthologs provide valuable evolutionary insights:

  • Sequence conservation analysis:

    • Detailed alignment of X. tropicalis DNAJC25 (368 amino acids) with human and other mammalian orthologs

    • Identification of highly conserved domains versus rapidly evolving regions

    • Calculation of selection pressures (dN/dS ratios) across different protein domains

  • Expression pattern comparison:

    • Compare tissue-specific expression profiles across species

    • The high liver expression in humans may or may not be conserved in X. tropicalis

    • Developmental expression timing comparison between species

  • Functional complementation studies:

    • Express X. tropicalis DNAJC25 in mammalian cells lacking endogenous DNAJC25

    • Assess rescue of phenotypes such as apoptosis sensitivity and colony formation

    • Chimeric proteins with domain swapping between species to identify functionally critical regions

  • Co-evolution network analysis:

    • Identify protein interaction partners that have co-evolved with DNAJC25

    • Compare interactome conservation between species

    • This reveals functionally important interactions maintained through evolution

  • Disease-associated variant effects:

    • Test whether disease-associated variants in human DNAJC25 have similar effects when introduced at equivalent positions in X. tropicalis DNAJC25

    • Evaluate conservation of pathological mechanisms across species

  • Environmental response conservation:

    • Compare stress-induced expression changes (heat shock, oxidative stress) between species

    • Assess whether tumor suppressor properties observed in human HCC models are conserved in X. tropicalis liver development or regeneration

These comparative approaches will establish which DNAJC25 functions represent ancient, conserved roles versus more recently evolved specialized functions, informing both basic biology and potential translational applications.

What are common pitfalls in DNAJC25 expression analysis, and how can they be avoided?

Researchers frequently encounter several challenges when analyzing DNAJC25 expression:

  • Reference gene selection issues:

    • Problem: Inappropriate reference genes leading to inaccurate normalization

    • Solution: Validate multiple reference genes (e.g., β2-MG, GAPDH, ACTB) in each specific tissue type and experimental condition before selecting the most stable ones

    • Recommendation: Use at least two reference genes and geometric averaging for more reliable normalization

  • Primer design challenges:

    • Problem: Amplification of related DNAJ family members due to sequence similarity

    • Solution: Design primers at unique regions, preferably spanning exon-exon junctions

    • Validation: Confirm specificity through sequencing of PCR products and melting curve analysis

  • Tissue heterogeneity confounding:

    • Problem: Variable cell type composition in tissue samples affecting expression measurements

    • Solution: Use laser capture microdissection for cell-type specific analysis or single-cell approaches

    • Alternative: In situ hybridization to visualize expression patterns within complex tissues

  • Post-transcriptional regulation overlook:

    • Problem: mRNA levels may not correlate with protein abundance due to post-transcriptional regulation

    • Solution: Complement RT-qPCR with Western blotting or mass spectrometry

    • Analysis: Compare mRNA and protein data to identify potential regulatory mechanisms

  • Antibody specificity issues:

    • Problem: Cross-reactivity with other DNAJ family proteins

    • Solution: Validate antibodies using overexpression and knockout controls

    • Approach: Consider peptide competition assays to confirm specific binding

  • Statistical analysis limitations:

    • Problem: Inappropriate statistical tests for non-normally distributed expression data

    • Solution: Perform normality tests before selecting parametric or non-parametric methods

    • Recommendation: Use larger sample sizes (n>30) particularly for clinical samples with high variability

By addressing these common pitfalls, researchers can achieve more reliable and reproducible DNAJC25 expression analysis results.

What methodological adaptations are needed when transitioning from in vitro to in vivo studies of DNAJC25 function?

Transitioning from in vitro to in vivo studies of DNAJC25 requires several methodological adaptations:

  • Expression system considerations:

    • In vitro: Plasmid-based overexpression or siRNA knockdown in cell lines

    • In vivo adaptation: Viral vectors for tissue-specific delivery or inducible expression systems

    • Consider AAV serotypes with liver tropism for hepatocyte-specific expression

  • Functional readout adjustments:

    • In vitro: Colony formation and flow cytometry for apoptosis

    • In vivo adaptation:

      • Tumor volume/weight measurements

      • TUNEL staining in tissue sections for apoptosis detection

      • Serum markers for liver function

  • Dosage and delivery optimization:

    • Determine effective in vivo dose based on in vitro dose-response curves

    • Establish pharmacokinetics and biodistribution profiles

    • Consider local versus systemic delivery methods based on target tissue

  • Temporal considerations:

    • In vitro: Typically short-term studies (hours to days)

    • In vivo adaptation: Design both acute and chronic studies (days to months)

    • Use inducible systems to control timing of expression changes

  • Physiological context integration:

    • Account for immune system interactions absent in cell culture

    • Consider organ crosstalk and systemic effects

    • Evaluate effects under various physiological stresses (e.g., partial hepatectomy for liver studies)

  • Model selection guidance:

    • For liver-specific studies: Consider both xenograft models and genetically engineered mouse models

    • For developmental studies: Xenopus tropicalis provides advantages for visualizing developmental effects

    • For mechanistic validation: Consider humanized mouse models expressing human DNAJC25

These adaptations ensure that findings from in vitro studies are appropriately translated to the more complex in vivo environment, accounting for the additional variables present in living organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.