Recombinant Xenopus tropicalis Dual oxidase maturation factor 1 (duoxa1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Xenopus tropicalis duoxa1 is a heterologously expressed protein essential for the maturation and functional activation of dual oxidase (DUOX) enzymes. It facilitates the endoplasmic reticulum (ER)-to-plasma membrane trafficking of DUOX, enabling its role in hydrogen peroxide (H₂O₂) production . In Xenopus tropicalis, duoxa1 ensures proper DUOX folding, glycosylation, and enzymatic activity, which are critical for innate immunity and thyroid hormonogenesis .

Functional Mechanism

  • DUOXA1 forms a 2:2 hetero-tetramer with DUOX1, enabling NADPH oxidase activity .

  • Calcium ions enhance catalytic activity by stabilizing dehydrogenase domain conformations .

  • Loss of DUOXA1 disrupts DUOX1 trafficking, leading to ER retention and functional impairment .

Comparative Analysis with Mammalian Orthologs

FeatureXenopus tropicalisHuman (DUOXA1)Mouse (Duoxa1)
Protein Length308 aa 343 aa 341 aa
Key DomainsTransmembrane helicesGST-tagged (79.9 kDa) His-tagged (full-length)
Functional RoleDUOX1 maturationThyroid hormonogenesis ER-to-plasma transport

Mechanistic Studies

  • Epithelial-Mesenchymal Transition (EMT): DUOXA1 silencing in lung cancer models promotes EMT and cancer stem cell features, highlighting its role in metastatic progression .

  • Thyroid Function: DUOXA1–DUOX1 complexes are indispensable for H₂O₂ production in thyroid hormonogenesis, with bidirectional promoters regulating their co-expression .

Disease Relevance

  • Cancer: Epigenetic silencing of DUOXA1 correlates with aggressive phenotypes in lung adenocarcinoma .

  • Neurogenesis: Human DUOXA1 is a p53-regulated factor involved in neuronal differentiation .

Future Directions

  • Structural Biology: Resolving DUOXA1’s role in DUOX redox regulation using cryo-EM and mutagenesis .

  • Therapeutic Targeting: Exploring DUOXA1 as a biomarker for cancers with dysregulated H₂O₂ signaling .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, serving as a reference for customers.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
duoxa1; Dual oxidase maturation factor 1; Dual oxidase activator 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
duoxa1
Target Protein Sequence
MQANIFPFYPQPRTSFKFDTKIIEIIIICIVTACTFIIILPGIRGKSRSIWLFRILTSLF IGAVILAVNFTSDWETGIVTATTVYKSFSHSMLNASIGLWIGLKGVNITLIGNPVYQLNE TINYNEEFAWESANQFDKNYKDGLERGLPYPILYVAEKFTINSPCGLFQQYCISTYYSSE IMWVAFGSWILYNVLFSMPVILYGICMMFVTAICMLVSLISFASVRQAPVCNIHFGNAVL KTHFGVSYWLSLVTGLFCLIVSLVLLFLYKTQPKVIRLIFSYGEEEDLSDKSENEEEHSS ALSLNEML
Uniprot No.

Target Background

Function
Potentially involved in the maturation and transport of functional dual oxidase from the endoplasmic reticulum to the plasma membrane.
Database Links
Protein Families
DUOXA family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis DUOXA1 and what is its primary function in biological systems?

DUOXA1 (Dual Oxidase Maturation Factor 1) is an essential protein that facilitates the proper functioning of DUOX1 (Dual Oxidase 1). In biological systems, DUOXA1 forms a heterodimeric complex with DUOX1, which is critical for the generation of hydrogen peroxide (H₂O₂). This complex plays a pivotal role in various physiological processes, including thyroid hormone synthesis, innate immune responses, and wound healing.

The DUOXA1-DUOX1 complex functions as an H₂O₂-generating system, which is particularly important in epithelial tissues. While most detailed studies have been conducted on mammalian DUOXA1, the Xenopus tropicalis ortholog likely serves similar functions with species-specific adaptations. Recent research has demonstrated that intact DUOXA1 is required for full activity of DUOX1 and subsequent H₂O₂ generation .

Why is Xenopus tropicalis preferred as a model organism for DUOXA1 research?

Xenopus tropicalis offers several significant advantages as a model organism for studying DUOXA1:

  • Diploid genome: Unlike its relative Xenopus laevis (which has an allotetraploid genome), X. tropicalis possesses a diploid genome, making it more amenable to genetic manipulation and analysis .

  • Genomic resources: The sequencing of the X. tropicalis genome by the Department of Energy's Joint Genome Institute has provided extensive genomic resources, including a reliable genetic map based on simple sequence length polymorphisms (SSLPs) .

  • Synteny with mammalian genomes: The X. tropicalis genome demonstrates remarkable synteny with mammalian genomes, often in stretches of a hundred genes or more, which is far greater than that observed between fish and mammals . This conservation facilitates comparative studies and translational research.

  • Experimental accessibility: The embryonic development of X. tropicalis occurs externally and is easily observable, allowing for detailed investigations of developmental processes and gene function.

  • Genetic manipulation: Methods for producing transgenic X. tropicalis and conducting genome editing are well-established, facilitating functional studies of genes like DUOXA1.

How does DUOXA1 contribute to the functional activity of DUOX1?

DUOXA1 is essential for the proper functioning of DUOX1 through several mechanisms:

  • Maturation support: DUOXA1 facilitates the proper folding, processing, and trafficking of DUOX1 to the plasma membrane where it can exert its enzymatic function.

  • Complex formation: DUOXA1 forms a heterodimeric complex with DUOX1, which is necessary for the activation of DUOX1's enzymatic activity.

  • H₂O₂ generation: Functional studies have demonstrated that transfection with wild-type DUOXA1 significantly increases H₂O₂ production compared with empty vector transfection, indicating its critical role in activating the DUOX1 enzyme .

  • Regulation of expression: DUOXA1 can influence the expression levels of DUOX1 at both the mRNA and protein levels. Functional studies have shown that mutations in DUOXA1 (such as p.R56W) can decrease DUOX1 expression, with a corresponding impairment in H₂O₂ generation .

Experimental evidence has shown that cells transfected with both wild-type DUOX1 and DUOXA1 in combination produce the highest amount of H₂O₂, whereas mutations in either component significantly reduce H₂O₂ generation .

What are the consequences of mutations in DUOXA1 on H₂O₂ generation and thyroid function?

Mutations in DUOXA1 can have significant effects on H₂O₂ generation and thyroid function:

  • Impaired H₂O₂ production: A heterozygous-missense mutation (c.166 C>T; p.R56W) identified in human DUOXA1 has been shown to decrease DUOX1 expression at both mRNA and protein levels, with a corresponding impairment in H₂O₂ generation (P < 0.01) .

  • Congenital hypothyroidism (CH): Mutations in DUOXA1 can cause CH by disrupting the coordination between DUOX1 and DUOXA1 in the generation of H₂O₂, which is essential for thyroid hormone synthesis .

  • Synergistic effects with DUOX1 mutations: Functional studies have demonstrated that cells transfected with both mutant DUOXA1 (p.R56W) and mutant DUOX1 (p.R1307Q) in combination show the most severe impairment in H₂O₂ generation compared to mutations in either gene alone .

  • Specific biochemical consequences: The p.R56W mutation in DUOXA1 has been shown to decrease DUOX1 mRNA levels, suggesting that DUOXA1 may influence DUOX1 gene expression or mRNA stability .

The experimental data below illustrates the impact of mutations on H₂O₂ generation:

Transfected VectorsRelative H₂O₂ ProductionStatistical Significance
Empty vectorBaseline-
Wild-type DUOX1IncreasedP < 0.01
Wild-type DUOXA1IncreasedP < 0.01
DUOX1 p.R1307QDecreased vs. WT DUOX1P < 0.01
DUOXA1 p.R56WDecreased vs. WT DUOXA1P < 0.01
WT DUOX1 + WT DUOXA1Maximum increaseP < 0.01
p.R1307Q + p.R56WMaximum decreaseP < 0.01

How does the expression and regulation of DUOXA1 differ across tissues in Xenopus tropicalis?

While the search results don't provide specific information about DUOXA1 expression patterns in Xenopus tropicalis, we can infer potential patterns based on mammalian studies:

  • Tissue-specific expression: In humans, DUOX1 is highly expressed in epithelial tissues, including the lung, pancreas, placenta, prostate, testis, and salivary gland . Since DUOXA1 functions in conjunction with DUOX1, it likely has a similar expression pattern in Xenopus tropicalis.

  • Developmental regulation: DUOXA1 expression likely varies during different developmental stages in X. tropicalis, particularly during organogenesis of tissues where DUOX1 function is critical.

  • Cytokine regulation: In mammalian systems, IL-4 and IL-13 induce DUOX1 gene expression in the respiratory tract epithelium . These cytokines may similarly regulate DUOXA1 expression in Xenopus, though species-specific differences may exist.

  • Transcriptional regulation: The transcriptional regulation of DUOXA1 is not completely characterized yet, but studies in mammals indicate that DUOXA1 might regulate the function of some transcription factors and induce STAT1, 3, and 6 phosphorylation .

Research investigating the tissue-specific expression and regulation of DUOXA1 in Xenopus tropicalis would contribute valuable insights to our understanding of this protein's evolutionary conservation and functional adaptations.

How do epigenetic mechanisms influence DUOXA1 expression and function?

Epigenetic mechanisms likely play important roles in regulating DUOXA1 expression and function, though specific information from Xenopus tropicalis is limited:

  • DNA methylation: In mammalian systems, DUOX1 is frequently silenced in epithelial-derived cancers by epigenetic mechanisms . This suggests that DNA methylation may be an important regulatory mechanism for the DUOX1/DUOXA1 system in Xenopus as well.

  • Histone modifications: The chromatin environment around the DUOXA1 gene likely influences its expression in different tissues and developmental stages.

  • Non-coding RNAs: MicroRNAs and other non-coding RNAs may regulate DUOXA1 mRNA stability and translation efficiency.

  • Gene-environment interactions: Environmental factors such as oxidative stress, inflammation, or exposure to toxins might induce epigenetic changes affecting DUOXA1 expression.

A comprehensive investigation of the epigenetic landscape surrounding the DUOXA1 gene in Xenopus tropicalis would provide valuable insights into its regulation and potential dysregulation in disease states.

What are the optimal conditions for expressing recombinant Xenopus tropicalis DUOXA1 in heterologous expression systems?

Expressing recombinant Xenopus tropicalis DUOXA1 in heterologous systems requires careful optimization:

  • Expression vector selection:

    • For mammalian expression, vectors with strong promoters like CMV or EF1α are recommended

    • For bacterial expression, codon optimization is essential due to differences between bacterial and amphibian codon usage

  • Cell line selection:

    • HeLa cells have been successfully used for DUOX1/DUOXA1 expression studies

    • HEK293 cells often provide high transfection efficiency for amphibian proteins

    • Insect cell systems (Sf9, High Five) may be valuable for higher protein yields

  • Co-expression considerations:

    • Co-transfection with DUOX1 is critical for functional studies

    • The ratio of DUOXA1 to DUOX1 plasmids should be optimized (1:1 ratio is often a good starting point)

  • Expression conditions:

    • Transfection: For HeLa cells, lipid-based transfection reagents have shown success

    • Incubation time: Peak expression is typically observed 24-48 hours post-transfection

    • Temperature: Standard incubation at 37°C for mammalian cells

  • Detection methods:

    • Western blot analysis using anti-DUOXA1 antibodies (may require cross-reactivity testing with Xenopus proteins)

    • RT-PCR to confirm mRNA expression levels

From published studies, the following transfection protocol has been successful for DUOXA1/DUOX1 expression:

  • Cell seeding: 2 × 10⁵ cells per well in 6-well plates

  • Transfection: 24 hours after seeding with 4 μg of expression vector

  • Analysis: Protein and functional assays performed 24-48 hours post-transfection

What assays can be used to measure DUOXA1-dependent H₂O₂ production in experimental systems?

Several assays can be employed to measure DUOXA1-dependent H₂O₂ production:

  • Amplex Red Assay:

    • This fluorometric assay utilizes the Amplex Red reagent, which reacts with H₂O₂ in the presence of horseradish peroxidase to produce highly fluorescent resorufin

    • Measurements are typically taken at excitation/emission wavelengths of 535/595 nm

    • A calibration curve using known H₂O₂ concentrations allows transformation of fluorescence intensity to nanomoles of H₂O₂

  • Horseradish Peroxidase (HRP)-dependent oxidation assays:

    • HRP-dependent oxidation of various substrates can be used to measure H₂O₂ production

    • Common substrates include tetramethylbenzidine (TMB) and 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid) (ABTS)

  • Genetically encoded H₂O₂ sensors:

    • HyPer: A genetically encoded fluorescent sensor specific for H₂O₂

    • roGFP2-Orp1: A redox-sensitive GFP fused to the H₂O₂-sensing domain of Orp1

  • Polarographic measurement:

    • Using a Clark-type electrode to measure oxygen consumption as an indirect measure of H₂O₂ production

Based on published research, the Amplex Red assay has been successfully employed to measure H₂O₂ generation in cells transfected with DUOX1 and DUOXA1. This method showed that cells transfected with both wild-type DUOX1 and DUOXA1 had the maximum fluorescence intensity, corresponding to the highest H₂O₂ production .

How can protein-protein interactions between DUOXA1 and DUOX1 be effectively studied?

Investigating protein-protein interactions between DUOXA1 and DUOX1 requires specialized techniques:

  • Co-immunoprecipitation (Co-IP):

    • Lysates from cells expressing tagged versions of DUOXA1 and DUOX1 can be subjected to immunoprecipitation

    • Lysis buffers containing 1% digitonin or 1% Triton X-100 preserve membrane protein interactions

    • Gentle washing conditions prevent disruption of protein complexes

    • Western blot analysis confirms the presence of interaction partners

  • Proximity Ligation Assay (PLA):

    • This technique allows visualization of protein interactions in situ

    • Requires specific antibodies against both DUOXA1 and DUOX1

    • Provides spatial information about interaction sites within cells

  • Förster Resonance Energy Transfer (FRET):

    • Fusion of fluorescent proteins (e.g., CFP to DUOXA1 and YFP to DUOX1)

    • Measures energy transfer between fluorophores when proteins interact

    • Can be performed in living cells to study dynamics of interactions

  • Split reporter systems:

    • Complementation assays using split luciferase or split GFP

    • Each fragment is fused to one of the proteins of interest

    • Functional reporter is reconstituted only when proteins interact

  • Bi-molecular Fluorescence Complementation (BiFC):

    • Similar to split reporter systems but specifically with fluorescent proteins

    • Allows visualization of interaction sites within cells

  • Surface Plasmon Resonance (SPR) or Biolayer Interferometry (BLI):

    • For in vitro analysis of purified recombinant proteins

    • Provides quantitative binding parameters (Kd, kon, koff)

When designing interaction studies, it's important to consider that DUOXA1 and DUOX1 are membrane proteins, which requires appropriate experimental conditions to preserve their native conformation and interaction potential.

How do disease-associated mutations in human DUOXA1 compare to equivalent regions in Xenopus tropicalis DUOXA1?

Comparing disease-associated human DUOXA1 mutations with equivalent regions in Xenopus tropicalis DUOXA1 provides insights into evolutionary conservation and disease mechanisms:

  • p.R56W mutation:

    • This heterozygous missense mutation (c.166 C>T) in human DUOXA1 has been associated with congenital hypothyroidism

    • The mutation changes a highly conserved arginine to tryptophan at residue 56

    • Functional analysis should examine whether this residue is conserved in Xenopus tropicalis DUOXA1 and whether mutation has similar functional consequences

  • Conservation analysis:

    • Multiple sequence alignment between human and Xenopus tropicalis DUOXA1 would reveal the degree of conservation at key functional residues

    • Higher conservation would be expected in domains involved in DUOX1 interaction or membrane localization

    • Regions showing divergence might indicate species-specific adaptations

  • Functional domain conservation:

    • The transmembrane domains that anchor DUOXA1 in the membrane are likely highly conserved

    • The DUOX1 interaction domains would be expected to show conservation proportional to the conservation of DUOX1 itself between species

  • Species-specific differences:

    • Differences in amino acid sequence might reflect adaptations to different physiological demands or environmental conditions

    • These differences could affect interaction strength, enzymatic activity, or regulatory mechanisms

Researchers should consider conducting site-directed mutagenesis of conserved residues in Xenopus tropicalis DUOXA1 corresponding to human disease mutations to determine if they produce similar functional defects.

Can Xenopus tropicalis DUOXA1 functionally replace human DUOXA1 in experimental systems?

The functional interchangeability of Xenopus tropicalis and human DUOXA1 is an important research question:

  • Cross-species complementation:

    • Transfection of Xenopus tropicalis DUOXA1 into human cell lines with DUOXA1 knockdown or knockout

    • Measurement of DUOX1 localization, activity, and H₂O₂ production

    • Comparison with human DUOXA1 complementation to quantify functional equivalence

  • Domain-specific analysis:

    • Creation of chimeric proteins containing domains from both human and Xenopus tropicalis DUOXA1

    • Identification of domains critical for species-specific functions

    • Evaluation of evolutionary constraints on different protein regions

  • Expected outcomes:

    • Partial complementation would indicate conserved core functions with species-specific adaptations

    • Complete complementation would suggest high functional conservation despite sequence divergence

    • No complementation would point to significant species-specific adaptations in the DUOX1-DUOXA1 system

  • Technical considerations:

    • Expression levels should be carefully controlled and normalized

    • Protein stability and half-life may differ between species and affect interpretation

    • Post-translational modifications might differ between expression systems

This type of cross-species complementation study can provide valuable insights into the evolutionary conservation of DUOXA1 function and identify regions critical for interaction with DUOX1 and H₂O₂ generation.

What can synteny analysis reveal about the evolution of the DUOXA1 gene in amphibians compared to mammals?

Synteny analysis of the DUOXA1 gene region can provide valuable evolutionary insights:

  • Genomic context conservation:

    • The X. tropicalis genome shows remarkable synteny with mammalian genomes, often in stretches of a hundred genes or more

    • Analysis of the genes flanking DUOXA1 in different species can reveal evolutionary relationships and constraints

  • Gene cluster organization:

    • In mammals, DUOXA1 is typically located near DUOXA2 and the DUOX genes

    • Comparing this organization in Xenopus tropicalis can reveal whether this clustering is conserved across vertebrates

    • Conserved clustering suggests functional constraints on gene organization

  • Evolutionary implications:

    • Conservation of synteny suggests selective pressure to maintain gene order

    • Breaks in synteny might indicate genomic rearrangements or duplications specific to certain lineages

    • The diploid genome of X. tropicalis makes it particularly valuable for such comparisons, in contrast to the allotetraploid X. laevis

  • Methodological approach:

    • Whole-genome alignment tools can identify syntenic blocks

    • Analysis of flanking genes and their functions can reveal functional relationships

    • Dating of duplication or divergence events can be estimated using molecular clock approaches

The remarkable degree of synteny between X. tropicalis and mammalian genomes suggests that synteny analysis of the DUOXA1 region could provide valuable insights into the evolution of this gene and its functional relationships with neighboring genes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.