Recombinant Xenopus tropicalis E3 ubiquitin-protein ligase MARCH2 (41335)

What is Xenopus tropicalis E3 ubiquitin-protein ligase MARCH2 and why is it significant for research?

Xenopus tropicalis E3 ubiquitin-protein ligase MARCH2 (also known as Membrane-associated RING finger protein 2 or MARCH-II) is an enzyme involved in the ubiquitination pathway, which tags proteins for degradation or alters their cellular functions. This particular protein is significant because it comes from Xenopus tropicalis (Western clawed frog), which has emerged as a powerful model organism for studying human disease genes and developmental processes. The protein's significance stems from its role in protein regulation through the ubiquitin pathway, which is fundamental to numerous cellular processes including protein degradation, cell cycle regulation, and immune responses. Unlike proteins from Xenopus laevis, studies with X. tropicalis proteins benefit from working with a true diploid genome with high conservation of gene synteny with humans, making experimental findings more directly applicable to human biology.

How does the structure and function of Xenopus tropicalis MARCH2 compare to its human counterpart?

The Xenopus tropicalis E3 ubiquitin-protein ligase MARCH2 contains characteristic domains including RING-CH finger domains that are essential for its ubiquitin ligase activity. Based on the amino acid sequence provided (MTTGDCCHLPGSLCDCTGSATFLKSLEESDLGRPQYVTQVTAKDGQLLSTVIKALGTQSDGPICRICHEGGNGERLLSPCDCTGTLGTVHKTCLEKWLSSSNTSYCELCHTEFAVERRPRPVTEWLKDPGPRNEKRTLFCDMVCFLFITPLAAISGWLCLRGAQDHLQFNSRLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRRTNQKVLLLIPDSKTAPTTHHSLLSSKLLKSASDETTV), the protein contains the critical RING-CH domain necessary for its catalytic function. The high degree of synteny between X. tropicalis and mammalian genomes suggests functional conservation of this protein. One methodological approach to comparing these proteins would be through phylogenetic analysis and structural modeling to identify conserved functional domains. Researchers interested in comparative studies should align the sequences using tools like CLUSTAL Omega and examine key domains required for substrate recognition and binding.

What are the technical specifications of recombinant Xenopus tropicalis MARCH2 for laboratory use?

The recombinant protein is typically available in quantities of 50 μg, with the specific tag type determined during the production process. The protein is stored in a Tris-based buffer with 50% glycerol, optimized specifically for this protein. For optimal stability, researchers should store the protein at -20°C for regular use, or at -80°C for extended storage periods. It is crucial to note that repeated freezing and thawing cycles should be avoided to maintain protein integrity and activity. For short-term experiments, working aliquots can be stored at 4°C for up to one week. The recombinant protein represents the full-length sequence (expression region 1-246) of the native protein and is cataloged under UniProt accession number Q28EX7.

How can Xenopus tropicalis MARCH2 be utilized in ubiquitination pathway studies?

To utilize recombinant X. tropicalis MARCH2 in ubiquitination pathway studies, researchers should first establish an in vitro ubiquitination assay system. This methodology requires purified recombinant MARCH2, E1 activating enzyme, appropriate E2 conjugating enzymes, ubiquitin, ATP, and potential substrate proteins. The reaction mixture should be incubated at 25-30°C (optimal for Xenopus proteins) for 1-2 hours, followed by analysis through western blotting to detect ubiquitinated products. When designing experiments, researchers should consider that X. tropicalis provides a unique advantage over other models due to its true diploid genome with remarkable synteny to mammalian genomes. This characteristic allows for more straightforward genetic manipulation and interpretation of results compared to models with duplicated genes (like X. laevis or zebrafish). For substrate identification studies, researchers can employ mass spectrometry-based approaches following immunoprecipitation with anti-MARCH2 antibodies from X. tropicalis tissues or cells.

What experimental protocols are recommended for studying MARCH2 protein interactions in Xenopus tropicalis models?

For studying protein interactions involving MARCH2 in X. tropicalis models, researchers should consider the following methodological approach:

• Yeast Two-Hybrid Screening: Use the MARCH2 protein as bait to identify potential interacting partners from a X. tropicalis cDNA library.

• Co-immunoprecipitation (Co-IP):

  • Express tagged MARCH2 in X. tropicalis embryos via mRNA microinjection

  • Lyse embryos at appropriate developmental stages

  • Perform immunoprecipitation with anti-tag antibodies

  • Identify co-precipitated proteins by mass spectrometry

• Proximity-Based Labeling:

  • Generate fusion constructs of MARCH2 with BioID or APEX2

  • Express in X. tropicalis embryos or tissue culture

  • Identify proximal proteins through streptavidin pulldown and mass spectrometry

X. tropicalis offers significant advantages for these studies due to its embryological advantages shared with X. laevis while maintaining a diploid genome that facilitates genetic interpretation. Additionally, the highly efficient transgenic system in Xenopus provides important complementary technology for evaluating protein interactions in vivo.

How should MARCH2 function be assessed in developmental studies using Xenopus tropicalis?

For developmental studies assessing MARCH2 function in X. tropicalis, researchers should implement a multi-faceted approach:

• Temporal and Spatial Expression Analysis:

  • Perform RT-qPCR to determine temporal expression patterns throughout development

  • Use whole-mount in situ hybridization to visualize spatial expression patterns

  • Compare with expression patterns of potential target proteins

• Loss-of-Function Studies:

  • CRISPR-Cas9 gene editing to generate knockout lines

  • Morpholino-mediated knockdown for stage-specific analyses

  • Dominant negative construct expression through mRNA injection

• Gain-of-Function Studies:

  • mRNA overexpression through microinjection

  • Transgenic lines with tissue-specific promoters driving MARCH2 expression

• Phenotypic Assessment:

  • Detailed morphological analysis at key developmental stages

  • Histological examination of affected tissues

  • Molecular marker analysis to assess impact on developmental pathways

X. tropicalis is particularly advantageous for these studies as it develops to sexual maturity in 1/3 the time of X. laevis, has 1/2 the genome size, and requires 1/5 the housing space, while sharing the embryological advantages of transparent embryos that develop externally. Recent advances in genome editing technologies have made it possible to efficiently disrupt gene function in Xenopus, reinforcing it as an excellent organism for modeling developmental processes and human diseases.

What are the optimal approaches for generating MARCH2 mutants in Xenopus tropicalis to study ubiquitination defects?

For generating MARCH2 mutants in X. tropicalis, researchers should consider these methodological approaches:

The generation of X. tropicalis mutants has been facilitated by genomic resources, particularly the availability of a reliable genetic map based on simple sequence length polymorphisms (SSLPs). Additionally, X. tropicalis offers significant advantages for genetic analysis due to the ease of generating haploid and gynogenetic diploid embryos, which greatly reduces the time and space needed to make inbred lines and perform genetic screens compared to other vertebrate models like mice. When creating MARCH2 mutants, researchers should focus specifically on the RING-CH domain, which is essential for the E3 ligase activity, and target conserved cysteine residues that coordinate zinc binding.

How can comparative studies between Xenopus tropicalis MARCH2 and orthologs in other species inform evolutionary conservation of ubiquitination pathways?

To conduct effective comparative studies between X. tropicalis MARCH2 and orthologs in other species, researchers should implement this methodological framework:

• Phylogenetic Analysis:

  • Perform comprehensive sequence alignment of MARCH2 proteins across species

  • Generate phylogenetic trees to illustrate evolutionary relationships

  • Identify conserved domains and species-specific variations

• Functional Complementation Assays:

  • Express MARCH2 orthologs from different species in X. tropicalis MARCH2-deficient backgrounds

  • Assess rescue of phenotypic defects

  • Quantify ubiquitination activity restoration

• Substrate Conservation Analysis:

  • Identify MARCH2 substrates in X. tropicalis

  • Test cross-species substrate recognition using in vitro ubiquitination assays

  • Verify conservation of ubiquitination sites through mass spectrometry

X. tropicalis provides unique advantages for these comparative studies due to its position in vertebrate evolution and its remarkable degree of synteny with mammalian genomes, often in stretches of a hundred genes or more, far greater than that seen between fish and mammals. This genomic organization makes X. tropicalis particularly valuable for studying the evolution of complex regulatory networks like ubiquitination pathways. Additionally, the Xenopus genus offers a unique resource for studying genome evolution through whole genome duplications, as it includes tetraploid, octoploid, and dodecaploid species in addition to the diploid X. tropicalis.

What are the challenges and solutions when investigating MARCH2 substrates in Xenopus tropicalis systems?

Investigating MARCH2 substrates in X. tropicalis systems presents several methodological challenges with corresponding solutions:

When addressing these challenges, researchers should leverage the unique advantages of X. tropicalis, including the ease of making tissue chimeras to determine whether defects are cell-autonomous or non-autonomous, and the ability to efficiently generate transgenic animals for tissue-specific expression studies. The amphibian embryos are particularly amenable to embryological manipulations, especially at gastrula and neurula stages, which becomes important for generating genetic chimeras and for spatial control of protein expression.

What are the critical parameters for successful storage and handling of recombinant Xenopus tropicalis MARCH2?

For optimal results with recombinant X. tropicalis MARCH2, researchers should adhere to these critical storage and handling parameters:

• Temperature Management:

  • Store stock solution at -20°C for regular use

  • Use -80°C for long-term storage to maintain enzymatic activity

  • Avoid repeated freeze-thaw cycles which significantly reduce protein activity

  • Maintain working aliquots at 4°C for no more than one week

• Buffer Composition:

  • The supplied Tris-based buffer with 50% glycerol is optimized for stability

  • For experimental assays, dilute in appropriate buffers containing reducing agents (1-5 mM DTT) to protect cysteine residues in RING domains

  • Consider including protease inhibitors when working with cell or tissue lysates

• Enzyme Activity Preservation:

  • Minimize exposure to extreme pH (<6.0 or >8.5)

  • Avoid oxidizing agents that may disrupt zinc coordination in RING domain

  • When designing ubiquitination assays, include zinc (10-50 μM) to maintain RING domain structure

The protein is supplied in a specialized buffer formulation (Tris-based with 50% glycerol) that has been optimized specifically for this protein to ensure stability and activity retention. When handling the protein for experimental procedures, researchers should work quickly and maintain cold temperatures to prevent degradation of the active sites critical for ubiquitin transfer activity.

How can researchers troubleshoot inconsistent results in MARCH2 ubiquitination assays?

When troubleshooting inconsistent results in MARCH2 ubiquitination assays, researchers should systematically examine these key parameters:

• Protein Activity Assessment:

  • Verify MARCH2 activity using known substrates before testing experimental conditions

  • Include positive controls in each experimental set

  • Check for proper folding using circular dichroism or limited proteolysis

• Reaction Component Verification:

  • Test all components individually (E1, E2, ubiquitin, ATP) with control reactions

  • Verify pH and buffer composition are optimal (typically pH 7.4-8.0)

  • Ensure proper ATP regeneration system if reactions extend beyond 30 minutes

• Analytical Approach Refinement:

  • For western blot detection, optimize antibody concentrations and blocking conditions

  • Consider using tagged ubiquitin (His, FLAG) for easier detection of modified products

  • For challenging substrates, try alternative detection methods like fluorescently labeled ubiquitin

• Substrate Considerations:

  • Verify substrate protein quality through gel analysis

  • Test different substrate concentrations (typically 0.1-1 μM range)

  • Consider native substrates from X. tropicalis for more physiologically relevant results

When designing these experiments, researchers should leverage the rich background of biochemical studies that have been performed in Xenopus systems, which provide a strong foundation for biochemical approaches. Additionally, the high conservation between X. tropicalis and human proteins makes it possible to adapt established protocols from human studies with appropriate modifications.

What controls are essential when studying MARCH2 function in Xenopus tropicalis developmental contexts?

When studying MARCH2 function in X. tropicalis developmental contexts, these essential controls must be incorporated:

• Genetic Controls:

  • Use siblings from the same mating for experimental and control groups

  • For CRISPR experiments, include both non-injected and non-targeting gRNA controls

  • For overexpression studies, use equivalent amounts of control mRNA (e.g., GFP)

• Rescue Experiments:

  • Demonstrate specificity by rescuing knockdown/knockout phenotypes with wild-type MARCH2

  • Use catalytically inactive MARCH2 (mutations in RING domain) to verify E3 ligase dependence

  • Consider rescue with orthologous MARCH2 from other species to assess functional conservation

• Dose-Dependency Verification:

  • Test multiple concentrations of morpholinos or mRNA to establish dose-response relationships

  • Include subphenotypic doses to identify genetic interactions

  • Document all developmental stages to capture temporal aspects of phenotypes

• Technical Controls:

  • Verify protein expression levels through western blotting

  • Perform RT-qPCR to confirm knockdown efficiency at the mRNA level

  • Include lineage tracers (e.g., fluorescent dextran) for microinjection experiments

X. tropicalis offers significant advantages for these controls due to its shorter generation time compared to X. laevis, making it more practical for genetic studies. Additionally, the ease of generating haploid and gynogenetic diploid embryos provides powerful tools for genetic analysis, particularly for mapping mutations. Researchers should also take advantage of the transparency of X. tropicalis tadpoles, which facilitates experimental manipulation and post-factum analysis of animals.

How might MARCH2 studies in Xenopus tropicalis contribute to understanding human disease mechanisms?

Studies of MARCH2 in X. tropicalis have significant potential to illuminate human disease mechanisms through several methodological approaches:

• Disease Model Generation:

  • Create X. tropicalis models mimicking human MARCH2 mutations using CRISPR-Cas9

  • Characterize phenotypes at molecular, cellular, and organismal levels

  • Test potential therapeutic interventions in these models

• Pathway Conservation Analysis:

  • Identify conserved MARCH2 substrates between X. tropicalis and humans

  • Map regulatory networks controlling MARCH2 expression and activity

  • Validate findings using patient-derived samples or data

• Therapeutic Target Identification:

  • Screen for modifiers of MARCH2-related phenotypes using chemical or genetic approaches

  • Validate hits in human cell systems

  • Develop assays for monitoring ubiquitination activity suitable for drug screening

X. tropicalis represents an excellent model for these studies because it has now emerged as a powerful aquatic model for studying human disease genes. Its immune system demonstrates striking similarities to that of mammals, making it relevant for immunological disease studies. Recent advances in genome editing technologies have made it possible to efficiently disrupt gene function in Xenopus, reinforcing it as an organism for modeling human disease. The high conservation of gene synteny with the human genome makes findings in X. tropicalis particularly relevant to human biology and disease mechanisms.

What emerging technologies could enhance the study of MARCH2 function in Xenopus tropicalis systems?

Several emerging technologies show promise for enhancing MARCH2 functional studies in X. tropicalis:

These technologies can be particularly effective in X. tropicalis due to its unique advantages as a model system. The transparent embryos that develop externally facilitate experimental manipulation and post-factum analysis, making optogenetic approaches especially powerful. The true diploid genome with high conservation of gene synteny with the human genome makes genetic engineering approaches more straightforward and translatable. Additionally, the highly efficient transgenic system in Xenopus provides an important complementary technology for implementing these emerging approaches.

How can systems biology approaches be applied to understand MARCH2's role in cellular networks using Xenopus tropicalis?

Systems biology approaches offer powerful methodologies for elucidating MARCH2's role in cellular networks:

• Multi-omics Integration:

  • Combine proteomics, transcriptomics, and metabolomics data from MARCH2-deficient X. tropicalis

  • Develop computational models of MARCH2-dependent regulatory networks

  • Identify network nodes most sensitive to MARCH2 perturbation

• Temporal Network Analysis:

  • Profile changes in ubiquitination patterns across developmental stages

  • Track dynamic changes in MARCH2 interactome during specific biological processes

  • Develop predictive models of temporal regulation

• Tissue-Specific Network Comparison:

  • Generate tissue-specific MARCH2 interactome maps

  • Identify common and divergent substrates across tissues

  • Correlate network differences with tissue-specific functions

• Perturbation Response Analysis:

  • Subject MARCH2-modified X. tropicalis to various stressors

  • Map changes in network responses compared to wild-type

  • Identify critical nodes conferring robustness or vulnerability

X. tropicalis is particularly well-suited for these systems approaches because the genome sequencing project confirmed its diploid genome status and showed remarkable synteny with mammalian genomes, often in stretches of a hundred genes or more. This genomic organization makes it ideal for network-level analyses that depend on clear orthology relationships. Furthermore, X. tropicalis has been a unique resource for studying large-scale genome organization issues and genome evolution, providing additional context for systems-level studies.