Recombinant Xenopus tropicalis E3 ubiquitin-protein ligase MARCH3 (41336)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
marchf3; march3; E3 ubiquitin-protein ligase MARCHF3; Membrane-associated RING finger protein 3; Membrane-associated RING-CH protein III; MARCH-III; RING-type E3 ubiquitin transferase MARCHF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
march3
Target Protein Sequence
MTTSRCSHLPEVLPDCTSSAPSGKTVEDCSSLVNGQPQYVMQVSAKDGQLLSTVVRTLTT QSFNDRPMCRICHEGSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFSV ERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLEA VGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILVIPKSANLPSAQQSLLGLH SFKRNSKETIV
Uniprot No.

Target Background

Function

MARCH3 is a recombinant Xenopus tropicalis E3 ubiquitin-protein ligase potentially involved in endosomal trafficking. E3 ubiquitin ligases receive ubiquitin from an E2 ubiquitin-conjugating enzyme via a thioester linkage and subsequently transfer it directly to target substrates.

Database Links
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.

Q&A

What is MARCH3 and what is its role in Xenopus tropicalis?

MARCH3 (Membrane-Associated RING-CH-3) is an E3 ubiquitin ligase localized to late endosomes and lysosomes in Xenopus tropicalis. It plays a crucial role in regulating endothelial barrier function by influencing the expression of tight junction proteins. Research has shown that MARCH3 functions as a negative regulator of barrier integrity, as its silencing results in strengthening of cell-cell contacts through the accumulation of junctional proteins . Molecularly, MARCH3 appears to function upstream of the FoxO1 forkhead transcription repressor, providing a potential mechanistic link between MARCH3 and signaling pathways involved in regulating junctional proteins and barrier integrity .

Why use Xenopus tropicalis as a model for studying MARCH3?

Xenopus tropicalis offers several advantages as a model system for studying MARCH3:

  • Unlike Xenopus laevis, X. tropicalis has a diploid genome, making it suitable for genetic analysis and manipulation .

  • It has a compact genome (~1.5×10^9 bp) that shows strong synteny with amniotes, simplifying orthology assignment and functional analysis .

  • The high conservation between frog and human genomes facilitates translational research relevance .

  • X. tropicalis can produce up to 9,000 embryos from a single mating, providing sufficient material for extensive phenotypic analyses .

  • The model offers rapid development with organ systems forming within days, allowing for efficient experimental timelines .

  • Various genetic tools including CRISPR and morpholino approaches have been well-established in this system .

How conserved is MARCH3 between Xenopus tropicalis and humans?

MARCH3 is highly conserved between Xenopus tropicalis and humans, reflecting its fundamental importance in cellular function. This conservation exists at multiple levels:

  • Sequence homology: The core catalytic RING-CH domain shows particularly high conservation

  • Subcellular localization: In both species, MARCH3 localizes to late endosomes/lysosomes

  • Functional conservation: MARCH3's role in regulating membrane protein trafficking appears to be conserved across vertebrates

This high degree of conservation makes X. tropicalis MARCH3 an excellent model for understanding human MARCH3 function and potential disease implications.

What phenotypes result from MARCH3 knockdown in Xenopus tropicalis?

Knockdown of MARCH3 in X. tropicalis results in several notable phenotypes:

  • Enhanced barrier integrity: MARCH3 silencing strengthens cell-cell contacts by increasing junctional protein accumulation

  • Resistance to permeability-inducing agents: Cells with MARCH3 knockdown show increased resistance to IL-8 and histamine-promoted permeability

  • Molecular changes: Upregulation of tight junction proteins, particularly occludin (OCLN) and claudin-5, as revealed by transcriptome analysis

  • Cytoskeletal effects: MARCH3-silenced cells resist cytokine-triggered cortical actin remodeling

These phenotypes collectively indicate that MARCH3 normally functions to regulate endothelial barrier integrity, with its absence leading to barrier strengthening.

What are the molecular targets of MARCH3 E3 ubiquitin ligase activity?

While the complete set of MARCH3 substrates remains to be fully characterized, research suggests several potential direct or indirect targets:

Potential TargetEvidenceFunctional Implication
Occludin (OCLN)Transcriptome analysis shows upregulation in MARCH3-depleted cells Regulation of tight junction integrity
Claudin-5Expression increases with MARCH3 silencing Modulation of endothelial barrier function
FoxO1 pathwayFoxO1 inactivation observed in MARCH3-depleted cells Transcriptional control of junctional proteins
VE-cadherinExpression affected (though to lesser extent than tight junction proteins) Adherens junction regulation

Recent studies indicate occludin can be regulated by ubiquitin-targeted degradation, and claudin has been reported to have at least two different lysine residues that serve as ubiquitin chain acceptors . Further research is needed to determine whether MARCH3 directly ubiquitinates these junction proteins or affects their expression through indirect mechanisms.

How does MARCH3 integrate with signaling pathways in endothelial barrier regulation?

MARCH3 appears to function within a broader signaling network regulating endothelial barrier integrity:

  • FoxO1 pathway: MARCH3 silencing causes inactivation of the FoxO1 transcription repressor, suggesting MARCH3 normally promotes FoxO1 activity

  • Adherens junction signaling: The effects of MARCH3 knockdown resemble a signaling pathway operating downstream of adherens junctions that regulates claudin-5 expression, where FoxO1 plays an instrumental role

  • Endocytic trafficking: MARCH3's localization to late endosomes/lysosomes suggests it may regulate the trafficking and degradation of membrane proteins

The molecular mechanisms connecting MARCH3 to these pathways remain to be fully elucidated, but may involve direct ubiquitination of pathway components or regulation of endosomal trafficking processes affecting signaling protein localization and activity.

What techniques can be used to manipulate MARCH3 expression in Xenopus tropicalis?

Several complementary approaches can be employed to alter MARCH3 expression in X. tropicalis:

  • Morpholino oligonucleotides (MOs): These antisense oligonucleotides can block MARCH3 translation or splicing. Research confirms that MOs function effectively in X. tropicalis .

  • CRISPR/Cas9 genome editing: This can be used to generate targeted mutations in the MARCH3 gene.

    • X. tropicalis is particularly amenable to CRISPR approaches due to its diploid genome

    • The high-quality genome assembly facilitates accurate guide RNA design

  • siRNA approaches: RNAi can be used for transient knockdown of MARCH3, as demonstrated in the screening of E3 ubiquitin ligases' effects on endothelial permeability .

  • Transgenesis: For overexpression or expression of tagged MARCH3 variants.

For experimental design, it's important to consider strain differences, as the Nigerian (N) strain was used for the genome assembly and may be more effectively targeted by sequence-based interventions like morpholinos compared to other strains like Ivory Coast (IC) .

How can MARCH3 ubiquitin ligase activity be assayed?

Assessing the E3 ubiquitin ligase activity of MARCH3 can be approached through several methodologies:

  • In vitro ubiquitination assays:

    • Recombinant MARCH3 can be tested for its ability to transfer ubiquitin to putative substrates

    • Required components include E1 activating enzyme, E2 conjugating enzyme, ubiquitin, ATP, and the substrate of interest

    • Western blotting can detect the formation of ubiquitinated products

  • Cell-based ubiquitination analysis:

    • Co-expression of MARCH3 with potential substrates in heterologous systems

    • Immunoprecipitation under denaturing conditions followed by ubiquitin detection

    • Use of proteasome inhibitors to enhance detection of ubiquitinated species

  • Ubiquitin linkage characterization:

    • Mass spectrometry to identify specific lysine residues modified by ubiquitin

    • Linkage-specific antibodies to determine ubiquitin chain topology (K48, K63, etc.)

When studying MARCH3 in X. tropicalis, it's important to consider that tight junction proteins like claudin have been shown to accept ubiquitin modifications on at least two different lysine residues , suggesting potential direct regulation by ubiquitin ligases like MARCH3.

What are the optimal conditions for recombinant expression of X. tropicalis MARCH3?

For successful recombinant expression of X. tropicalis MARCH3, consider the following optimized parameters:

Expression SystemAdvantagesConsiderations
E. coliFast growth, high yieldMembrane protein, may require solubility tags
Insect cellsBetter for eukaryotic proteinsLonger production time, more complex
Mammalian cellsNatural post-translational modificationsLower yield, higher cost

Key considerations:

  • MARCH3 is a transmembrane protein, which can present challenges for soluble expression

  • Including only the cytosolic RING-CH domain can improve solubility for functional studies

  • Adding purification tags (His, GST, MBP) can facilitate isolation

  • Co-expression with interacting partners may improve stability

When conducting X. tropicalis research, it's advantageous that many analytical reagents developed for X. laevis can be effectively transferred to X. tropicalis, potentially simplifying the development of tools for studying MARCH3 .

How can endothelial barrier function be assessed following MARCH3 manipulation?

Several complementary approaches can be used to evaluate endothelial barrier function after MARCH3 knockdown or overexpression:

  • Permeability assays:

    • Transwell permeability assays using fluorescent-labeled dextran

    • Electrical impedance measurements (TEER - Trans-Endothelial Electrical Resistance)

    • These methods have successfully detected MARCH3 knockdown effects on barrier integrity

  • Junctional protein visualization:

    • Immunofluorescence microscopy of tight junction (occludin, claudin-5) and adherens junction (VE-cadherin) proteins

    • Quantification of junctional continuity and intensity

  • Cytoskeletal organization:

    • F-actin staining to assess cortical actin organization

    • Analysis of stress fiber formation in response to permeability-inducing agents

  • In vivo microvascular permeability:

    • Microangiography techniques in X. tropicalis tadpoles

    • Tracking extravasation of labeled tracers in response to MARCH3 manipulation

When designing these experiments, it's important to note that X. tropicalis embryos develop at similar rates to X. laevis but tolerate a narrower range of temperatures , which should be considered when optimizing experimental conditions.

What transcriptomic approaches are most informative for understanding MARCH3 function?

Transcriptomic analysis has proven valuable for elucidating MARCH3 function, particularly through revealing its impact on junctional protein expression . The following approaches are recommended:

  • RNA-Seq analysis:

    • Compare MARCH3 knockdown/knockout to controls

    • Focus analysis on junctional proteins, trafficking machinery, and cytoskeletal regulators

    • Apply pathway enrichment to identify broader functional impacts

  • Temporal transcriptomics:

    • Analyze expression changes at different developmental stages

    • X. tropicalis offers the advantage of synchronized development for precise temporal studies

  • Single-cell RNA-seq:

    • Particularly useful for understanding cell-type-specific effects

    • Can reveal heterogeneous responses within tissues

  • Integrative analysis approaches:

    • Compare transcriptomic changes with proteomic data

    • Correlate with phenotypic measurements of barrier function

X. tropicalis' well-characterized developmental staging system allows for precise temporal correlation of transcriptomic changes with developmental events.

How can X. tropicalis MARCH3 research inform human disease understanding?

Research on MARCH3 in X. tropicalis has significant translational potential for understanding human pathologies:

  • Vascular disorders:

    • MARCH3's role in endothelial barrier regulation may be relevant to conditions involving vascular leakage

    • Potential implications for inflammatory disorders, sepsis, and edema

  • Genetic disease modeling:

    • X. tropicalis is increasingly recognized as a valuable model for human genetic disorders

    • High conservation of MARCH3 between species supports translational relevance

  • Drug discovery:

    • Identification of compounds that modulate MARCH3 activity could lead to therapies targeting endothelial barrier dysfunction

    • X. tropicalis allows for rapid, cost-effective screening approaches

The growing availability of genome-editing tools for X. tropicalis enables precise modeling of human MARCH3 variants to assess their functional impacts.

What are the challenges in extrapolating X. tropicalis MARCH3 findings to human systems?

While X. tropicalis offers many advantages for studying MARCH3, researchers should consider several limitations when translating findings to human contexts:

  • Evolutionary distance:

    • Despite high conservation, species-specific differences in MARCH3 function may exist

    • Regulatory networks may differ between amphibians and mammals

  • Developmental context:

    • Most X. tropicalis studies focus on embryonic/tadpole stages

    • Translating to adult human physiology requires careful consideration

    • Research has historically focused on pre-metamorphic stages in Xenopus, with fewer comparative studies on adult physiology and aging

  • Tissue-specific differences:

    • Vascular architecture and endothelial biology have some distinct features in amphibians

    • Expression patterns of MARCH3 interacting partners may vary between species

  • Phenotypic variability:

    • Human disease-associated variants often show variable penetrance and expressivity

    • This complexity may be difficult to fully recapitulate in X. tropicalis models

Despite these challenges, the conservation of fundamental cellular processes makes X. tropicalis MARCH3 research valuable for understanding basic mechanisms likely to be conserved in humans.

What are the key unsolved questions regarding MARCH3 function?

Several critical aspects of MARCH3 biology remain to be elucidated:

  • Direct ubiquitination targets:

    • Identification of the specific proteins directly ubiquitinated by MARCH3

    • Characterization of ubiquitin chain types and modification sites

  • Regulatory mechanisms:

    • How is MARCH3 activity itself regulated?

    • What stimuli modulate its expression, localization, or enzymatic activity?

  • Pathway integration:

    • Detailed mapping of how MARCH3 connects to the FoxO1 signaling pathway

    • Integration with other barrier-regulating pathways

  • Developmental roles:

    • Temporal requirements for MARCH3 during X. tropicalis development

    • Potential roles beyond endothelial barrier regulation

Research suggests that occludin can be regulated by ubiquitin-targeted degradation and claudin has multiple ubiquitin acceptor sites , but whether MARCH3 directly modifies these proteins remains to be determined.

What emerging technologies could advance X. tropicalis MARCH3 research?

Several cutting-edge approaches could significantly enhance our understanding of MARCH3 function:

  • Base editing and prime editing:

    • Precise introduction of specific mutations without double-strand breaks

    • Particularly valuable for modeling human variants

  • Inducible gene manipulation systems:

    • Temporal control of MARCH3 expression or activity

    • Can help distinguish developmental versus physiological roles

  • Proteomics approaches:

    • Proximity labeling (BioID, APEX) to identify MARCH3 interactors

    • Ubiquitinome analysis to comprehensively identify substrates

  • Advanced imaging:

    • Live imaging of MARCH3 trafficking and dynamics

    • Super-resolution microscopy of junction organization

  • Single-cell multi-omics:

    • Integrated analysis of transcriptome, proteome, and ubiquitinome

    • Cell-type-specific effects of MARCH3 manipulation

These technologies can leverage the experimental advantages of X. tropicalis, such as its diploid genome, high fecundity, and rapid development , to drive significant advances in our understanding of MARCH3 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.