Recombinant Xenopus tropicalis Ectonucleoside triphosphate diphosphohydrolase 7 (entpd7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
entpd7; TGas060f02.1; Ectonucleoside triphosphate diphosphohydrolase 7; NTPDase 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-610
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
entpd7
Target Protein Sequence
MARISFSCLFPASWHCSLPSVTQFSRQRVALLIISVAVFILVFAAVADLQLWSSRAFRDR QFRRYLDQIEDLEATDTKDTKLNYGVVVDCGSSGSRVFVYFWPPHNGNPHDLLDIKQMRD RGSKPVVKKIKPGISTMALTPEKSSDYINPLLSFAASYIPKHKHKETPLYILCTAGMRIL PESQQIAILQDLVKDVPQEFDFLFSEAHAEVISGKQEGVYAWISINFVLGRFDHVVDEED AVVAVTIGTQEESIIRKRTVGVIDMGGGSLQIAYEVPTTMTYPSVEHEEVAKSMLAEFNL GCDLQHTEHVYRVYVTTFMGFGGNFARQRYEDMVFNDTITKNRIQGQQIGVHPNSPLQDP CLPVGLIDQVRRQSHDLHVLGKGNWDSCRQQLEPLLLKSNDTQAYLNSVYQPSIDFSNSE FYGFSEFFYCTEDVLRMGGIYNSQKFAKAAKEYCSMPWTTLQDRFNSGLYSSHADQHRLK YQCFKSAWMFSILHNGFHFPHEYPNFKTAQLVYDKEVQWTLGAILYKTRFLPLRDIRQES SRPAHVSWFRISFVYNHYLFFACILVVLLSIVLYILRLRRIHRRQARASALDLLLMEEGV HTVLEPGIPT
Uniprot No.

Target Background

Function
This recombinant Xenopus tropicalis Ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7) catalyzes the hydrolysis of nucleoside triphosphates and diphosphates in a calcium- or magnesium-dependent manner. It exhibits preferential hydrolysis of nucleoside 5'-triphosphates, with substrate preference: UTP > GTP > CTP. ATP and nucleoside diphosphate hydrolysis occurs to a minor extent.
Database Links
Protein Families
GDA1/CD39 NTPase family
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Q&A

What is Ectonucleoside Triphosphate Diphosphohydrolase 7 (entpd7) and why is it studied in Xenopus tropicalis?

Ectonucleoside Triphosphate Diphosphohydrolase 7 (entpd7) belongs to the E-NTPDase family of ectonucleotidases, which play crucial roles in extracellular nucleotide-mediated signaling pathways. These enzymes dictate cellular responses by mediating the stepwise degradation of extracellular nucleotides to nucleosides . Xenopus tropicalis provides an excellent model for studying entpd7 because its genome is diploid (unlike the tetraploid X. laevis) and shows robust synteny with amniote genomes, simplifying orthology assignment and functional analysis . The experimental advantages of X. tropicalis include robust embryological, molecular, and biochemical assays that can be readily applied to study gene function, making it an ideal system for investigating entpd7's role in developmental and physiological processes.

What are the key structural features and conserved domains of Xenopus tropicalis entpd7?

Xenopus tropicalis entpd7, like other members of the E-NTPDase family, is characterized by highly conserved sequence domains known as "apyrase conserved regions" (ACRs). There are five such regions, labeled ACR1 through ACR5, which are involved in the catalytic cycle of the enzyme . The full-length protein consists of 610 amino acids with a predicted molecular structure that includes these conserved domains essential for nucleotide hydrolysis. The protein sequence contains specific motifs necessary for binding and hydrolyzing nucleotides, with the complete amino acid sequence available for reference in product specifications . These structural features are supported by deletion and mutation experiments that have confirmed their importance in the protein's enzymatic function .

How does recombinant Xenopus tropicalis entpd7 differ from its native form?

The recombinant Xenopus tropicalis entpd7 protein available for research purposes is produced in E. coli expression systems and contains an N-terminal His-tag to facilitate purification and detection . This differs from the native form in several key aspects. The recombinant protein spans the full length (amino acids 1-610) of the native sequence but includes the additional His-tag sequence that is not present in the endogenous protein. Additionally, since it's expressed in a prokaryotic system (E. coli), the recombinant protein may lack post-translational modifications that would normally occur in eukaryotic cells. Researchers should be aware that these differences might influence protein folding, enzymatic activity, or interaction with other biomolecules when compared to the native form expressed in Xenopus tissues.

What are the optimal storage and reconstitution conditions for maintaining the activity of recombinant Xenopus tropicalis entpd7?

For optimal storage of recombinant Xenopus tropicalis entpd7, the protein should be stored at -20°C to -80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . The lyophilized powder form of the protein should be briefly centrifuged prior to opening to bring contents to the bottom. For reconstitution, it is recommended to dissolve the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance stability for long-term storage, adding glycerol to a final concentration of 5-50% is advised, with 50% being the standard default concentration. After reconstitution, working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity .

How can researchers verify the purity and activity of recombinant Xenopus tropicalis entpd7?

To verify the purity of recombinant Xenopus tropicalis entpd7, researchers should first perform SDS-PAGE analysis, which can confirm if the protein preparation meets the expected purity standard of greater than 90% . For activity verification, researchers should consider an enzymatic assay that measures the protein's ability to hydrolyze nucleotide substrates such as ATP or ADP. Typically, this involves incubating the recombinant protein with substrates under optimal buffer conditions (pH and temperature) and measuring either the disappearance of substrates or the appearance of hydrolysis products using HPLC, colorimetric, or spectrophotometric methods. When designing activity assays, researchers should consider the conserved catalytic domains (ACR1-ACR5) that are essential for the hydrolytic function of E-NTPDases . A comprehensive activity assessment should include kinetic parameters determination (Km and Vmax) and comparison with data from other E-NTPDase family members.

What experimental approaches are most effective for studying entpd7 function in Xenopus tropicalis models?

For studying entpd7 function in Xenopus tropicalis, researchers can employ three primary experimental approaches that leverage the unique advantages of this model organism. First, cell-free egg extracts can be used as a biochemical system to study the molecular interactions and functional role of entpd7 in fundamental cellular processes . Second, oocyte expression systems are particularly valuable for studying ion transport and channel physiology related to entpd7 function; this approach involves microinjecting recombinant mRNAs encoding wild-type or mutant entpd7 into oocytes followed by single-cell physiological analysis . Third, experiments using developing Xenopus embryos and tadpoles allow for in vivo functional analysis through gene manipulation techniques such as morpholino-mediated knockdown or CRISPR gene mutations combined with overexpression of wild-type or mutant proteins via mRNA injection or tissue-specific transgenics . The well-defined fate map of Xenopus embryos enables targeted injection into specific tissues, and the unique advantage of unilateral injection allows manipulation of one side of the embryo while the contralateral side serves as an internal control .

How can CRISPR-Cas9 genome editing be optimized for studying entpd7 function in Xenopus tropicalis?

To optimize CRISPR-Cas9 genome editing for studying entpd7 function in Xenopus tropicalis, researchers should begin by carefully designing guide RNAs (gRNAs) that specifically target conserved functional domains within the entpd7 gene, particularly the apyrase conserved regions (ACRs) . Multiple gRNAs targeting different exons can be tested to identify those with highest editing efficiency. Microinjection of Cas9 protein (rather than mRNA) complexed with in vitro transcribed gRNAs into one-cell stage embryos typically yields higher efficiency with fewer off-target effects. For verification of editing, researchers should employ T7 endonuclease assays, direct sequencing, or high-resolution melt analysis of PCR amplicons spanning the target site. Taking advantage of Xenopus tropicalis's diploid genome status simplifies genotyping compared to the tetraploid X. laevis . For phenotypic analysis, researchers can utilize the unique ability to perform unilateral injections, allowing the uninjected side to serve as an internal control while examining tissue-specific effects of entpd7 disruption . Finally, integration of high-throughput molecular approaches such as RNA-Seq can provide valuable insights into downstream effects of entpd7 disruption on gene expression networks.

What methods are recommended for analyzing the tissue-specific expression patterns of entpd7 in Xenopus tropicalis?

For analyzing tissue-specific expression patterns of entpd7 in Xenopus tropicalis, researchers should employ a multi-faceted approach combining both RNA and protein detection methods. In situ hybridization using antisense probes designed against the entpd7 mRNA sequence can visualize spatial expression patterns in embryos and tissue sections. This technique can be complemented with quantitative RT-PCR or RNA-Seq for precise quantification of expression levels across different tissues and developmental stages. For protein-level analysis, immunohistochemistry or immunofluorescence using antibodies against the Xenopus tropicalis entpd7 protein is recommended, though researchers may need to validate commercial antibodies for cross-reactivity or develop custom antibodies. The expression as phenotype (EaP) approach, which integrates gene expression data with anatomical phenotypes, can be particularly powerful for characterizing how experimental manipulations affect entpd7 expression in specific tissues . For temporal regulation studies, stage-specific analysis during embryonic development can reveal critical periods of entpd7 function. Additionally, transgenic reporter lines expressing fluorescent proteins under the control of the entpd7 promoter can provide real-time visualization of expression patterns in living embryos.

How can researchers effectively use recombinant entpd7 to study its enzymatic activity and substrate specificity?

To effectively study the enzymatic activity and substrate specificity of recombinant Xenopus tropicalis entpd7, researchers should implement a comprehensive biochemical characterization approach. Begin by determining the optimal reaction conditions, including pH, temperature, and divalent cation requirements (typically Ca²⁺ or Mg²⁺) for maximum activity. A systematic analysis of substrate preferences should test various nucleotide triphosphates (ATP, GTP, CTP, UTP) and diphosphates to establish the enzyme's substrate hierarchy. Kinetic parameters (Km, Vmax) should be determined for each substrate using Michaelis-Menten analysis to quantify substrate affinity and catalytic efficiency. To assess the functional importance of specific protein domains, particularly the ACR regions (ACR1-ACR5) , site-directed mutagenesis of conserved amino acid residues followed by activity assays can reveal critical catalytic or regulatory sites. Native gel electrophoresis and size exclusion chromatography can provide insights into the oligomeric state of the active enzyme. For more detailed structural studies, circular dichroism spectroscopy can characterize secondary structure elements, while advanced techniques like X-ray crystallography or cryo-electron microscopy might elucidate the three-dimensional structure. Finally, inhibitor studies using known E-NTPDase inhibitors can further characterize the enzyme's catalytic mechanism and potentially identify entpd7-specific inhibitors for functional studies.

How conserved is entpd7 across vertebrate species, and what can this tell us about its evolutionary significance?

The evolutionary conservation of entpd7 across vertebrate species provides valuable insights into its functional importance. Ectonucleotidases like entpd7 belong to the E-NTPDase family that contains highly conserved sequence domains known as "apyrase conserved regions" (ACRs) . These domains have been maintained throughout vertebrate evolution, suggesting a critical role in nucleotide metabolism. Comparative genomic analysis reveals that the entpd7 gene shows strong synteny between Xenopus tropicalis and amniote genomes, facilitating orthology assignment and functional analysis across species . The Xenopus tropicalis genome has particular value for evolutionary studies because it is diploid (unlike the tetraploid X. laevis) and has a compact genome size of approximately 1.5×10⁹ bp, similar to zebrafish . This genomic conservation allows researchers to draw parallels between entpd7 function in amphibians and mammals, potentially informing human disease models. Differences in tissue-specific expression patterns or enzymatic properties of entpd7 between species may reflect adaptations to specific physiological demands. Analyzing these evolutionary patterns can help identify regions of the protein under selective pressure versus those that permit greater variation, guiding structure-function studies and the development of species-specific tools for entpd7 modulation.

What are common challenges in working with recombinant Xenopus tropicalis entpd7, and how can they be addressed?

Researchers working with recombinant Xenopus tropicalis entpd7 commonly encounter several challenges that require specific methodological approaches. First, protein solubility issues may arise during expression or after reconstitution. To address this, researchers should optimize buffer conditions by testing various pH ranges, salt concentrations, and consider adding stabilizing agents such as glycerol (5-50%) . Loss of enzymatic activity during storage represents another common challenge; this can be mitigated by storing the protein at -20°C to -80°C in small aliquots to avoid repeated freeze-thaw cycles, which significantly impact protein stability . When reconstituting the lyophilized protein, centrifuging the vial briefly before opening ensures that all material is collected at the bottom, preventing loss of product . If enzymatic assays show suboptimal activity, researchers should verify that essential cofactors (typically divalent cations like Ca²⁺ or Mg²⁺) are present at appropriate concentrations, as these are critical for E-NTPDase function . Contaminating phosphatases from the expression system may interfere with nucleotidase activity measurements; using highly purified protein preparations (>90% purity as confirmed by SDS-PAGE) and incorporating specific inhibitors of other phosphatase classes in enzymatic assays can help isolate entpd7-specific activity. Finally, for applications requiring native folding, researchers should consider that the prokaryotic expression system may not recapitulate all post-translational modifications present in the native Xenopus protein.

How can researchers effectively design experiments to study the role of entpd7 in Xenopus tropicalis development?

Designing effective experiments to study entpd7's role in Xenopus tropicalis development requires careful consideration of temporal and spatial factors. Researchers should first establish a detailed expression profile of entpd7 throughout development using techniques such as quantitative RT-PCR, in situ hybridization, and immunohistochemistry to identify when and where the gene is active. This temporal-spatial map guides subsequent functional studies by highlighting critical developmental windows and tissues for investigation. For functional manipulation, both loss-of-function and gain-of-function approaches should be employed. Loss-of-function can be achieved through CRISPR-Cas9 genome editing or antisense morpholino oligonucleotides targeting entpd7 , while gain-of-function studies can utilize microinjection of synthetic mRNA encoding wild-type or mutant entpd7. The unique advantage of unilateral injection in Xenopus embryos allows manipulation of one side while the contralateral side serves as an internal control , significantly strengthening experimental design. To connect entpd7 function with specific developmental processes, researchers should examine multiple phenotypic endpoints including morphological abnormalities, tissue-specific marker expression, cell proliferation, apoptosis, and differentiation markers. High-throughput approaches such as RNA-Seq can reveal broader transcriptional networks affected by entpd7 manipulation . Finally, rescue experiments, where wild-type entpd7 is co-expressed with morpholinos or in CRISPR-mutant backgrounds, provide compelling evidence for the specificity of observed phenotypes.

How might high-throughput approaches advance our understanding of entpd7 function in Xenopus tropicalis?

High-throughput approaches offer tremendous potential for advancing our understanding of entpd7 function in Xenopus tropicalis across multiple biological scales. At the genomic level, CRISPR-Cas9 screens targeting different domains of entpd7 could systematically identify critical functional regions while generating an allelic series for phenotypic comparison. Transcriptomic profiling using RNA-Seq following entpd7 manipulation can reveal downstream gene regulatory networks and signaling pathways influenced by this ectonucleotidase across different developmental stages and tissues . The integration of gene expression phenotypes with anatomical phenotypes, termed the "expression as a phenotype" (EaP) approach, can comprehensively characterize how entpd7 perturbation affects both gene expression patterns and morphological outcomes . Proteomic approaches including mass spectrometry-based interactome studies could identify protein-protein interaction networks involving entpd7, potentially uncovering novel functional associations. Metabolomic profiling focused on nucleotide metabolism could provide direct evidence of entpd7's impact on extracellular nucleotide pools and downstream signaling. High-content imaging combined with fluorescent reporters can enable real-time visualization of entpd7 activity and its effects on cellular processes in live embryos. Finally, the application of systems biology approaches to integrate these multi-omic datasets would enable the construction of comprehensive models describing entpd7's role in development and physiology, generating testable hypotheses about its function in specific biological contexts.

What potential roles might entpd7 play in modeling human diseases using Xenopus tropicalis?

Xenopus tropicalis provides a powerful system for modeling human diseases related to entpd7 dysfunction due to the conservation of fundamental genes, signaling pathways, and biological functions between amphibians and humans . Entpd7, as a member of the E-NTPDase family, regulates extracellular nucleotide-mediated signaling pathways , which are implicated in various human pathologies. Researchers could leverage Xenopus tropicalis to model disorders involving nucleotide metabolism dysregulation, particularly those affecting tissues where entpd7 is highly expressed. The experimental advantages of Xenopus, including cell-free egg extracts, oocyte expression systems, and manipulable embryos, offer multiple approaches for disease modeling . For instance, oocytes could express human entpd7 variants identified in patients to assess functional consequences through electrophysiological measurements. Embryo-based studies could evaluate developmental abnormalities resulting from entpd7 mutations that mimic human conditions. The ability to perform targeted injections and utilize unilateral manipulations with contralateral controls provides robust experimental designs for assessing disease mechanisms . Additionally, high-throughput data integration approaches being developed within the Xenopus research community, including the integration of gene expression datasets with phenotypic outcomes, can facilitate systems-level analysis of disease pathways . The Xenbase resource further supports disease modeling by curating Xenopus literature and integrating data with orthologous human genes, anatomy information, and links to human disease resources like OMIM and the Human Disease Ontology .

What are the key takeaways for researchers working with Xenopus tropicalis entpd7?

Researchers working with Xenopus tropicalis entpd7 should recognize several key considerations that will optimize their experimental approaches and data interpretation. First, understanding the structural features of the protein, particularly the five apyrase conserved regions (ACRs) critical for catalytic function, provides essential context for designing functional studies . When using recombinant protein, proper storage and handling protocols are crucial; specifically, storing at -20°C to -80°C, avoiding repeated freeze-thaw cycles, and reconstituting in appropriate buffers with glycerol as a stabilizer will maintain protein integrity and activity . The experimental advantages of the Xenopus tropicalis model system—including its diploid genome with strong synteny to amniotes, robust embryological and molecular assays, and the ability to produce large numbers of embryos—make it particularly valuable for entpd7 studies . Researchers have three primary experimental approaches at their disposal: cell-free egg extracts for biochemical studies, oocyte expression systems for electrophysiological analyses, and embryonic manipulations for developmental investigations . The integration of multiple experimental modalities, from gene editing to high-throughput omics approaches, will yield the most comprehensive understanding of entpd7 function. Finally, researchers should leverage the growing bioinformatic resources available through platforms like Xenbase, which connect Xenopus data with human disease information , facilitating translational insights from this model organism to human health applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.