Recombinant Xenopus tropicalis Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ergic3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. To request a specific tag, please indicate this in your order; we will prioritize fulfilling such requests.
Synonyms
ergic3; Endoplasmic reticulum-Golgi intermediate compartment protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
ergic3
Target Protein Sequence
MESLHRLRQFDAYPKTLEDFRVKTCGGALVTVISGLIMLILFFSELQYYLTKEIYPELFV DKSRGDKLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDKKPVTSEAD RHELGKSEEHVVFDPKSLDPNRCESCYGAETDDFSCCNTCDDVREAYRRRGWAFKTPDSI EQCKREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDN INMTHEIRHLSFGRDYPGLVNPLDGSSVAAMQSSMMFQYFVKIVPTVYVKVDGEVLRTNQ FSVTRHEKMTNGLIGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVA GLIDSLVYYSTRAIQKKIELGKAT
Uniprot No.

Target Background

Function
Potential role in endoplasmic reticulum-Golgi transport.
Database Links
Protein Families
ERGIC family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis and why is it used as a model organism for studying proteins like ergic3?

Xenopus tropicalis is a small, fast-breeding, diploid frog species that has become increasingly important in developmental genetics and functional genomics research. Introduced as a model system in the early 1990s, X. tropicalis complements the widely used Xenopus laevis while offering several significant advantages for protein research .

Unlike X. laevis (which is allotetraploid), X. tropicalis has a diploid genome, making it more suitable for genetic analysis and easier genome sequencing . Its diploid structure is more likely to conserve gene function with mammalian species, providing better translational relevance for proteins like ergic3 . Additionally, X. tropicalis features:

  • Shorter generation time (4-6 months versus 1-2 years for X. laevis)

  • Smaller adult size, requiring less laboratory space

  • Higher throughput experimental capacity

  • More straightforward genetic manipulation for studying protein function

  • Greater synteny with mammalian genomes, often in stretches of a hundred genes or more

These advantages make X. tropicalis particularly valuable for multigenerational experiments such as transgenic lines and mutant generation that can reveal protein functions in complex developmental contexts .

What is the function of ergic3 protein in Xenopus tropicalis?

Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ergic3) in Xenopus tropicalis plays a critical role in intracellular protein trafficking between the endoplasmic reticulum (ER) and the Golgi apparatus. This 384-amino acid protein (UniProt ID: Q6NVS2) functions as part of the dynamic membrane system that mediates bidirectional transport of cargo proteins .

The primary functions of ergic3 include:

  • Facilitating protein transport from the ER to the Golgi apparatus

  • Participating in the quality control of newly synthesized proteins

  • Contributing to the structural organization of the ER-Golgi intermediate compartment

  • Potentially regulating selective cargo transport through interactions with other trafficking proteins

In developmental contexts, proper ergic3 function is essential for the secretory pathway that underlies embryonic patterning, tissue differentiation, and morphogenesis in X. tropicalis. Disruptions in ergic3 function could potentially impact numerous developmental processes that depend on properly regulated protein secretion.

What are the best methods for recombinant expression of X. tropicalis ergic3?

Successful recombinant expression of X. tropicalis ergic3 requires careful consideration of expression systems and purification strategies. Based on established protocols, the following methodological approach is recommended:

Expression Systems Comparison:

Expression SystemAdvantagesDisadvantagesSuitability for ergic3
E. coli (BL21)High yield, cost-effective, rapid growthLimited post-translational modifications, inclusion body formationEffective for full-length ergic3 with His-tag
Insect cells (Sf9/Hi5)Better protein folding, some post-translational modificationsHigher cost, longer production timeSuitable for functional studies requiring proper folding
Mammalian cells (HEK293/CHO)Native-like modifications, proper foldingLowest yield, highest costBest for interaction studies requiring authentic modifications

For standard biochemical studies, E. coli expression has been successfully employed for producing His-tagged full-length X. tropicalis ergic3 (residues 1-384) . The protocol typically involves:

  • Cloning the ergic3 coding sequence into a pET-series vector with an N-terminal His-tag

  • Transforming expression-optimized E. coli strains (BL21(DE3) or Rosetta)

  • Inducing protein expression with IPTG (typically 0.1-0.5 mM) at reduced temperature (16-20°C)

  • Harvesting cells and lysing under native conditions

  • Purifying via nickel affinity chromatography followed by size exclusion chromatography

This approach yields protein suitable for biochemical characterization, antibody production, and in vitro interaction studies.

How can I optimize reconstitution of lyophilized X. tropicalis ergic3 for maximum activity?

Proper reconstitution of lyophilized ergic3 protein is critical for maintaining structural integrity and functional activity. The following protocol maximizes protein stability and activity:

  • Initial handling: Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitution buffer selection:

    • Primary recommendation: Use deionized sterile water for initial reconstitution to 0.1-1.0 mg/mL

    • Alternative buffers for specific applications:

      • For enzymatic assays: 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 1 mM DTT

      • For structural studies: 20 mM HEPES, pH 7.4, 150 mM NaCl

      • For interaction studies: PBS (pH 7.4) with 0.1% BSA

  • Reconstitution procedure:

    • Add buffer slowly to the lyophilized protein

    • Gently rotate or flick the tube (avoid vigorous vortexing)

    • Allow 15-30 minutes at room temperature for complete dissolution

    • If needed, gently pipette to ensure full dissolution

  • Stabilization: Add glycerol to a final concentration of 5-50% (default recommendation is 50%) for long-term storage stability

  • Storage conditions:

    • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

    • For short-term use (up to one week): Store at 4°C

    • For long-term storage: Store aliquots at -20°C/-80°C

Careful attention to these reconstitution parameters will ensure maximum retention of ergic3 functional properties for downstream applications.

What are effective methods for studying ergic3 localization in X. tropicalis cells?

Investigating the subcellular localization of ergic3 in X. tropicalis cells requires specialized techniques that preserve the delicate architecture of the ER-Golgi interface. The following methodological approaches are recommended:

Immunofluorescence microscopy protocol:

  • Sample preparation:

    • For cultured cells: Fix X. tropicalis cells with 4% paraformaldehyde (10 min), permeabilize with 0.1% Triton X-100

    • For tissue sections: Cryosection fixed tissue at 10-12μm thickness

  • Immunostaining:

    • Block with 5% normal goat serum in PBS (1 hour)

    • Primary antibodies (overnight, 4°C):

      • Anti-ergic3 antibody (1:200-1:500)

      • Anti-KDEL (ER marker, 1:500)

      • Anti-GM130 (cis-Golgi marker, 1:250)

    • Secondary antibodies (1 hour, room temperature):

      • Species-appropriate Alexa Fluor conjugates (1:500)

    • Counterstain nuclei with DAPI (1:1000, 5 min)

  • Confocal microscopy settings:

    • Use high-resolution confocal microscopy with Airyscan or similar technology

    • Z-stacks at 0.3μm intervals

    • Sequential scanning to prevent bleed-through

  • Colocalization analysis:

    • Calculate Pearson's correlation coefficient for quantitative assessment

    • Perform Manders' overlap coefficient analysis for partial colocalization

Live imaging in X. tropicalis embryos:

For dynamic tracking of ergic3 in developing embryos, microinjection of mRNA encoding fluorescently tagged ergic3 constructs is recommended . This approach can be supplemented by RNA-Seq data analysis from X. tropicalis developmental stages to correlate localization patterns with expression dynamics .

How can I design CRISPR-Cas9 experiments to target ergic3 in X. tropicalis?

Designing effective CRISPR-Cas9 experiments to target ergic3 in X. tropicalis requires careful consideration of guide RNA design, delivery methods, and validation strategies. X. tropicalis offers significant advantages for CRISPR experiments due to its diploid genome, which simplifies targeting compared to the allotetraploid X. laevis .

Step-by-step CRISPR design protocol:

  • Target site selection:

    • Identify early exons in ergic3 gene to maximize disruption probability

    • Use X. tropicalis genome browser to identify conserved regions

    • Check for SNPs between laboratory strains that might affect targeting

    • Select sequences with minimal off-target potential

  • Guide RNA design criteria:

    • Ensure 20-nucleotide target sequences adjacent to NGG PAM sites

    • Aim for 40-60% GC content for optimal efficiency

    • Avoid homopolymer stretches (>4 of the same nucleotide)

    • Verify specificity using X. tropicalis genome-specific CRISPR design tools

  • Delivery methods comparison:

Delivery MethodAdvantagesDisadvantagesEfficiency
mRNA injectionSimple, rapid expressionTransient, variable concentrationHigh initial, decreases over time
Plasmid DNASustained expressionSlower onset, mosaicismModerate, longer duration
RNP complexImmediate activity, reduced off-targetsTechnical complexityHigh, short duration
  • Microinjection protocol:

    • Inject one-cell stage embryos at the animal pole

    • Typical injection volumes: 2-5 nl

    • Cas9 mRNA concentration: 300-500 pg/embryo

    • sgRNA concentration: 100-200 pg/embryo

  • Validation strategies:

    • T7 endonuclease I assay to detect indels

    • Direct sequencing of PCR amplicons

    • High-resolution melt analysis for rapid screening

    • Western blotting to confirm protein reduction

  • Addressing mosaicism:

    • Raise F0 animals to adulthood

    • Outcross with wild-type animals to identify germline transmission

    • Screen F1 offspring for heterozygous mutations

    • Intercross F1 carriers to obtain homozygous F2 mutants

This approach leverages X. tropicalis' advantages as a genetic model system, facilitating the generation of stable ergic3 mutant lines for comprehensive functional studies .

What techniques can reveal ergic3 interaction partners in X. tropicalis?

Identifying protein interaction partners of ergic3 in X. tropicalis requires a combination of complementary techniques that balance sensitivity, specificity, and physiological relevance. The following methodological approaches are recommended:

Immunoprecipitation-Mass Spectrometry (IP-MS):

  • Prepare X. tropicalis tissue or cell lysates in a buffer preserving native interactions

  • Immunoprecipitate ergic3 using specific antibodies coupled to Protein A/G beads

  • Process samples for LC-MS/MS analysis

  • Employ label-free quantification to identify enriched proteins

  • Use appropriate controls (IgG pulldowns, untransfected cells)

  • Filter data with statistical threshold (typically fold change >2, p<0.05)

Proximity-dependent Biotin Identification (BioID):

  • Generate a fusion construct of ergic3 with BirA* biotin ligase

  • Express in X. tropicalis cells or via microinjection into embryos

  • Supply biotin for 16-24 hours to label proximal proteins

  • Lyse cells/embryos under harsh conditions

  • Capture biotinylated proteins with streptavidin beads

  • Identify by mass spectrometry

FRET/BRET analysis for specific interactions:

For validating individual interactions identified through high-throughput methods, Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) approaches can be employed. These techniques are particularly valuable for monitoring interactions in live X. tropicalis cells or embryos.

Data integration and validation:

To minimize false positives, integration of multiple datasets is essential. The table below summarizes a validation framework:

Validation ApproachMethodologyStrength of Evidence
Reciprocal IPPull down with antibody against interactor, detect ergic3Strong
Co-localizationImmunofluorescence showing spatial overlapModerate
Domain mappingTruncation/mutation to identify interaction regionsStrong
Functional assayssiRNA knockdown of interactor affecting ergic3 functionStrong
Evolutionary conservationInteraction preserved in X. laevis and mammalian systemsModerate-Strong

This comprehensive strategy leverages the experimental tractability of X. tropicalis to establish a high-confidence interactome for ergic3.

How can conflicting data about ergic3 function in X. tropicalis be resolved?

Resolving conflicting experimental results regarding ergic3 function requires systematic analysis of methodological differences, biological variables, and careful experimental design. This structured approach can help reconcile seemingly contradictory findings:

Systematic analysis framework:

  • Methodological reconciliation:

    • Compare protein sources (recombinant vs. native ergic3)

    • Evaluate antibody specificity and epitope locations

    • Assess knockdown/knockout approaches (morpholinos vs. CRISPR)

    • Consider timing differences in developmental studies

  • Biological variables assessment:

    • Document X. tropicalis strain differences

    • Compare developmental stages precisely

    • Consider maternal contribution of ergic3 mRNA/protein

    • Evaluate temperature effects on experimental outcomes

  • Resolution experiment design:

    The following experimental design can help resolve conflicting data:

    • Simultaneous comparison: Perform parallel experiments using multiple methodologies

    • Dose-response analysis: Test across concentration ranges to identify threshold effects

    • Temporal resolution: Conduct fine-grained time-course experiments

    • Redundancy assessment: Investigate potential compensation by related proteins

  • Multi-omics integration:

    Combine X. tropicalis RNA-Seq data with proteomic and functional analyses to build an integrated model of ergic3 function. This approach can reveal context-dependent functions that may explain apparently conflicting observations.

Decision matrix for conflicting results:

Conflict TypeExampleResolution ApproachExpected Outcome
Knockdown phenotype differencesGrowth defects vs. no effectDirect comparison with standardized reagents and techniquesIdentification of stage or dose-dependent threshold effects
Localization discrepanciesER-restricted vs. Golgi-associatedHigh-resolution time-lapse imaging with multiple markersDetection of dynamic trafficking patterns
Binding partner inconsistenciesDifferent interactors in different studiesSystematic IP-MS with controlled conditions and statistical thresholdsComprehensive interactome with confidence scores
Expression pattern differencesUbiquitous vs. tissue-specificRNA-Seq across developmental stages with spatial transcriptomicsResolution of temporal and spatial expression dynamics

By systematically addressing methodological and biological variables, researchers can develop a more nuanced understanding of ergic3 function that accommodates apparently conflicting observations.

What are common challenges when working with recombinant X. tropicalis ergic3?

Working with recombinant X. tropicalis ergic3 presents several technical challenges that researchers should anticipate and address proactively. The following troubleshooting guide addresses the most common issues:

Expression and purification challenges:

ProblemPossible CausesSolutions
Low expression yieldProtein toxicity, codon bias, inclusion body formationUse Rosetta strains for rare codons, lower induction temperature (16°C), add 0.5-1% glucose to reduce leaky expression
Protein degradationProtease activity, unstable domainsAdd protease inhibitors, purify at 4°C, consider adding stabilizing agents like glycerol or mild detergents
Poor solubilityHydrophobic transmembrane domainsExpress truncated versions without transmembrane regions, use detergents (0.1% DDM or 0.5% CHAPS)
Aggregation after purificationImproper folding, concentration too highAdd reducing agents (1mM DTT), limit protein concentration (<1mg/ml), include 10% glycerol
His-tag inaccessibilityTag buried in protein structureConsider C-terminal tag placement, use denaturing conditions for initial binding

Functional assay challenges:

ProblemPossible CausesSolutions
No detectable activityMisfolding, cofactor absence, improper assay conditionsVerify protein folding by circular dichroism, supplement with potential cofactors, optimize buffer conditions
Activity loss upon storageFreeze-thaw damage, oxidationStore as aliquots with 50% glycerol , add reducing agents, avoid repeated freeze-thaw cycles
Inconsistent resultsBatch-to-batch variation, degradationUse single batch for complete study, verify integrity by SDS-PAGE before each experiment
High background in binding assaysNon-specific interactionsIncrease washing stringency, add competitors (0.1% BSA), optimize blocking conditions

Addressing these common challenges proactively will significantly improve experimental outcomes when working with recombinant X. tropicalis ergic3 protein.

How can I optimize antibody specificity for X. tropicalis ergic3 in different applications?

Achieving high antibody specificity for X. tropicalis ergic3 requires careful consideration of epitope selection, validation strategies, and application-specific optimizations. The following comprehensive approach ensures reliable detection across multiple experimental contexts:

Epitope selection strategy:

  • Ideal target regions:

    • N-terminal regions (amino acids 1-60) outside transmembrane domains

    • Unique sequences not conserved in related family members

    • Regions with predicted high antigenicity and surface accessibility

    • Avoid sequences with post-translational modification sites

  • Antibody validation roadmap:

    A systematic validation approach should include:

    • Western blot with positive controls (recombinant protein ) and negative controls

    • Peptide competition assays to confirm specificity

    • Testing in tissues with known expression patterns

    • Cross-validation with multiple antibodies targeting different epitopes

    • Testing in knockout/knockdown samples

  • Application-specific optimization:

ApplicationCritical ParametersOptimization Strategy
Western blottingSample preparation, transfer efficiencyUse fresh samples with phosphatase/protease inhibitors, optimize SDS-PAGE conditions (7.5-12% gels), PVDF membranes, 5% milk blocking
ImmunofluorescenceFixation method, antibody penetrationTest multiple fixatives (4% PFA vs. methanol), use 0.1-0.3% Triton X-100, incubate primary antibody at 4°C overnight
ImmunoprecipitationAntibody binding capacity, non-specific bindingPre-clear lysates, use protein A/G mixture beads, include 0.1% NP-40 in IP buffer
Flow cytometrySurface accessibility, fixation/permeabilizationTest saponin vs. Triton permeabilization, use higher antibody concentrations, validate with GFP-tagged ergic3 controls
ChIP assaysCrosslinking efficiency, chromatin fragmentationOptimize formaldehyde concentration (0.5-1%), verify sonication to 200-500bp fragments

This comprehensive approach to antibody development and validation ensures reliable detection of X. tropicalis ergic3 across diverse experimental applications. Particular attention should be paid to specificity validation to avoid cross-reactivity with related proteins in the secretory pathway.

What are emerging techniques for studying ergic3 dynamics in X. tropicalis?

Recent technological advances offer exciting new opportunities for investigating ergic3 dynamics in X. tropicalis with unprecedented spatial and temporal resolution. These emerging techniques are transforming our understanding of protein trafficking and function in this important model organism:

Super-resolution microscopy approaches:

  • STORM/PALM imaging:

    • Achieves 20-50nm resolution to resolve individual ergic3-containing vesicles

    • Requires photoswitchable fluorophore-tagged ergic3

    • Enables quantitative analysis of ergic3 clustering and organization

  • Lattice light-sheet microscopy:

    • Provides gentle, high-speed 3D imaging of living embryos

    • Ideal for tracking ergic3-positive vesicles in developing X. tropicalis

    • Reduces phototoxicity for extended time-lapse imaging

Optogenetic tools for ergic3 manipulation:

  • Photoswitchable ergic3 variants:

    • LOV domain fusions for light-controlled ergic3 activity

    • Enables precise temporal control of protein function

    • Can be implemented in developing X. tropicalis embryos

  • Optical dimerization systems:

    • CRY2/CIB1 or iLID system fusions with ergic3

    • Allows inducible recruitment to specific cellular compartments

    • Helps dissect spatial requirements for ergic3 function

Multi-omics integration approaches:

The rapidly expanding RNA-Seq datasets from X. tropicalis provide opportunities for integrating transcriptomic data with proteomic and functional analyses to develop comprehensive models of ergic3 regulation and function.

X. tropicalis organoid systems:

Emerging organoid technologies using X. tropicalis stem cells enable studying ergic3 function in tissue-specific contexts that better recapitulate the complexity of in vivo environments while maintaining experimental accessibility.

These cutting-edge approaches leverage the experimental advantages of X. tropicalis as a model organism while incorporating the latest technological innovations to provide unprecedented insights into ergic3 biology.

How might functional studies of ergic3 in X. tropicalis inform human disease research?

Research on ergic3 in X. tropicalis has significant translational potential for understanding human diseases, particularly those involving secretory pathway dysfunction. The remarkable synteny between X. tropicalis and mammalian genomes facilitates cross-species insights that can directly inform human health research.

Disease relevance of ergic3 pathway dysfunction:

  • Neurodegenerative disorders:

    • Protein trafficking defects contribute to several neurodegenerative diseases

    • X. tropicalis ergic3 studies can reveal fundamental mechanisms of ER-Golgi transport stress

    • Potential applications to Alzheimer's, Parkinson's, and ALS research

  • Developmental disorders:

    • Secretory pathway function is critical for embryonic patterning and organogenesis

    • X. tropicalis ergic3 mutations may model congenital disorders involving protein trafficking defects

    • Can inform understanding of human developmental syndromes with ER-Golgi dysfunction

  • Cancer biology:

    • Altered secretory pathway function is implicated in cancer progression

    • X. tropicalis ergic3 studies can elucidate roles in cell proliferation and migration

    • May identify novel therapeutic targets in secretory pathway machinery

Translational research strategies:

X. tropicalis ApproachHuman Disease ApplicationTranslational Advantage
CRISPR-engineered ergic3 mutationsModel patient-specific variantsRapid generation of tailored disease models
High-throughput drug screeningIdentify secretory pathway modulatorsEfficient in vivo screening platform
Tissue-specific ergic3 manipulationOrgan-specific disease modelingReveals tissue-specific requirements and vulnerabilities
Synthetic genetic interaction screensIdentify genetic modifiers of disease severityReveals potential therapeutic targets and pathways

The combination of X. tropicalis' experimental tractability with its close evolutionary relationship to humans makes it an ideal model system for translational research on ergic3 and related secretory pathway components. Future studies bridging X. tropicalis findings with human patient data hold significant promise for developing novel therapeutic approaches for secretory pathway disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.