Recombinant Xenopus tropicalis Epoxide hydrolase 3 (ephx3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ephx3; abhd9; Epoxide hydrolase 3; EH3; Abhydrolase domain-containing protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
ephx3
Target Protein Sequence
MQLYLSRLLLIVTRTALRVTGVFFWVLVYVAALLAAVSYIPDALRLLTRGPLSAFRWGPR KAAPACLTSSAHGQHGYIRMKDSGIRFHYVASGDKRNPLMLLLHGFPENWYSWRYQLDEF SNGYRTVAIDLRGFGGSDAPSRLEDYKMEILLQDLQDLIRGLGYSRCVLVGHDWGGTLAW TFAVRHRDMVTHLIVMNAPHPSAFHDYVLSHPSQLFSSRYVFLFQLPLIPEILLSLRDFE HIKKPLTDATHGIQNVECKLSKEEVEAFVYYPSQKGALTPPLNYYRNLFGFFPVKAQDVL VPTLLLWGEHDAFLEAAMVPEMQQYVRAPFRAEIIPNASHWLQQDRPQEVNKIIRDFLKE DFLVHRN
Uniprot No.

Target Background

Function

Recombinant Xenopus tropicalis Epoxide Hydrolase 3 (Ephx3)

This enzyme catalyzes the hydrolysis of epoxide-containing fatty acids. It exhibits in vitro activity against epoxyeicosatrienoic acids (EETs), including 8,9-EET, 9,10-EET, 11,12-EET, and 14,15-EET, as well as leukotoxin.

Database Links
Protein Families
AB hydrolase superfamily, Epoxide hydrolase family
Subcellular Location
Microsome membrane; Single-pass membrane protein.

Q&A

What are the primary experimental applications of recombinant Xenopus tropicalis EPHX3?

Recombinant Xenopus tropicalis EPHX3 serves several important experimental applications:

  • Enzyme kinetics studies: Characterizing substrate specificity and catalytic efficiency toward various epoxide substrates, particularly linoleate-derived epoxides

  • Comparative biochemistry: Examining evolutionary conservation of epoxide hydrolase function across species

  • Structural biology investigations: Analyzing protein structure-function relationships in the epoxide hydrolase family

  • Immunological assays: Used as an antigen for antibody production and in ELISA assays for detecting EPHX3 in biological samples

  • In vitro hydrolysis assays: Testing the enzyme's ability to hydrolyze various epoxide substrates under controlled conditions

For optimal experimental use, recombinant EPHX3 should be stored at -20°C, with extended storage at -80°C, and working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles .

How does EPHX3 function differ from other epoxide hydrolases (EPHX1 and EPHX2) in epoxide metabolism?

EPHX3 demonstrates distinct substrate preferences and physiological roles compared to other epoxide hydrolases:

Epoxide HydrolaseCellular LocalizationPrimary SubstratesPhysiological RoleKnockout Phenotype
EPHX1 (microsomal)Endoplasmic reticulumArachidonic acid-derived epoxidesXenobiotic metabolismNo significant effect on EpOME hydrolysis alone
EPHX2 (soluble/sEH)CytosolMultiple epoxy fatty acids, especially EETsRegulation of inflammation, pain, blood pressureReduced DiHOME formation
EPHX3Membrane-boundLinoleate epoxides, especially esterified epoxyalcoholsSkin barrier function, ceramide metabolismModest skin barrier impairment, reduced ceramide-bound triols

Research with knockout mice has revealed that EPHX3 plays a specialized role in the hydrolysis of specific epoxyalcohols in the epidermal 12R-lipoxygenase pathway, particularly the conversion of 9R,10R-trans-epoxy-11E-13R-hydroxy-octadecenoate to 9R,10S,13R-trihydroxy-11E-octadecenoate . Unlike EPHX1 and EPHX2, EPHX3 shows a remarkable preference for this epoxyalcohol substrate, hydrolyzing it at 31-fold (human EPHX3) and 39-fold (murine EPHX3) higher rates compared to 14,15-EET hydrolysis by soluble epoxide hydrolase .

Interestingly, while in vitro studies suggested EPHX3 efficiently hydrolyzes soluble linoleate epoxides (EpOMEs), knockout mouse studies demonstrated that EPHX3 deficiency does not significantly affect EpOME metabolism in vivo, indicating that its physiological role may be more specialized for esterified substrates .

What is the physiological significance of EPHX3 in epidermal barrier function based on knockout studies?

Knockout studies have revealed that EPHX3 plays a specific role in maintaining epidermal barrier function, though its impact is more subtle than other proteins in the pathway:

  • Increased transepidermal water loss (TEWL): Ephx3-/- mice show a modest but statistically significant increase in TEWL (approximately 45% higher than wild-type), indicating impaired skin barrier function .

  • Reduced covalently bound ceramides: Ephx3-/- mice exhibit a significant decrease (40% reduction) in covalently bound ceramides in the epidermis, affecting the structural integrity of the water barrier .

  • Isomer-specific reduction in linoleate-derived triols: LC-MS analysis revealed a marked reduction (approximately 85%) in the esterified linoleate-derived 9R,10S,13R-trihydroxy-11E-octadecenoate in Ephx3-/- epidermis .

  • Specificity of EPHX3 function: Studies comparing Ephx1-/-, Ephx2-/-, and Ephx3-/- mice showed that only Ephx3 disruption affected skin barrier function, with combined knockout of all three not further enhancing the effects observed in Ephx3-/- alone .

The phenotype of Ephx3-/- mice is notably milder than knockouts of other proteins in the epidermal barrier pathway (such as 12R-LOX, eLOX3, or SDR9C7), which often result in lethal increases in TEWL. This suggests that EPHX3 may serve to fine-tune the barrier function rather than being absolutely essential for survival .

How can Xenopus tropicalis EPHX3 serve as a model for understanding human EPHX3 function in disease pathways?

Xenopus tropicalis EPHX3 can serve as a valuable model for understanding human EPHX3 function in disease pathways due to several factors:

  • Evolutionary conservation: Basic enzymatic functions of epoxide hydrolases are conserved across species, allowing for comparative studies of substrate specificity and catalytic mechanisms.

  • Experimental adaptability: The Xenopus system offers advantages for heterologous expression and functional studies, including the ability to study embryonic development.

  • Disease modeling: While human EPHX3 has been implicated in skin barrier disorders, Xenopus models can help elucidate conserved pathways in epidermal development and barrier formation.

Human EPHX3 is highly expressed in the proximal digestive tract, bone marrow, lymphoid tissues, and skin . Its role in skin barrier function, particularly in the metabolism of linoleate-derived epoxides in ceramides, suggests potential involvement in skin disorders characterized by barrier dysfunction. The specialized function of EPHX3 in hydrolyzing esterified epoxide substrates (rather than free fatty acid epoxides) opens new perspectives on its potential roles in pathophysiology beyond the skin .

What are the optimal conditions for expressing and purifying functional recombinant Xenopus tropicalis EPHX3?

For optimal expression and purification of functional recombinant Xenopus tropicalis EPHX3, researchers should consider the following methodological approaches:

  • Expression system selection:

    • Prokaryotic systems (E. coli) may be suitable for truncated versions lacking transmembrane domains

    • Eukaryotic systems (insect cells, mammalian cells) are preferred for full-length protein to ensure proper folding and post-translational modifications

  • Purification strategy:

    • Affinity chromatography using appropriate tags (His-tag, GST-tag) determined during the production process

    • Size exclusion chromatography for further purification

    • Ion exchange chromatography to remove contaminants

  • Buffer optimization:

    • Storage in Tris-based buffer with 50% glycerol

    • Buffer optimization specific to EPHX3 stability

    • Addition of protease inhibitors to prevent degradation

  • Quality control:

    • Enzymatic activity assays using model substrates (e.g., EpOMEs)

    • SDS-PAGE to confirm purity

    • Western blotting to verify identity

  • Storage conditions:

    • Store at -20°C for regular use or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Maintain working aliquots at 4°C for up to one week

What are the recommended protocols for assessing EPHX3 enzymatic activity in experimental systems?

To accurately assess EPHX3 enzymatic activity, researchers should implement the following protocols:

  • Substrate selection and preparation:

    • For soluble assays: 9,10-EpOME or 12,13-EpOME

    • For specialized studies: 9R,10R-trans-epoxy-11E-13R-hydroxy-octadecenoate (epoxyalcohol)

    • Consider both free fatty acid forms and esterified substrates (to mimic physiological conditions)

  • In vitro enzymatic assays:

    • Incubation of purified EPHX3 with substrate under controlled temperature and pH

    • Time-course measurements to determine initial velocities

    • Inclusion of appropriate controls (heat-inactivated enzyme, substrate without enzyme)

  • Activity quantification methods:

    • Liquid chromatography-mass spectrometry (LC-MS/MS) for detecting and quantifying diol and triol products

    • High-performance liquid chromatography (HPLC) with appropriate derivatization for improved detection

    • For esterified substrates in tissues: sodium borohydride reduction followed by normal-phase HPLC of DMP acetonide PFB esters

  • Comparative experimental design:

    • Parallel testing with EPHX1 and EPHX2 to distinguish specific EPHX3 activity

    • Inclusion of specific inhibitors where available

    • Assessment across different pH and temperature conditions to determine optima

  • Tissue-specific analyses:

    • For skin studies: Analysis of ceramide-bound linoleate derivatives

    • Preparation of cellular fractions (cytosolic and microsomal) for separate activity assessment

    • Tissue-specific extraction protocols to maintain enzyme viability

How can researchers overcome challenges in studying membrane-bound EPHX3 compared to soluble epoxide hydrolases?

Membrane-bound epoxide hydrolases like EPHX3 present unique challenges compared to soluble forms (like EPHX2/sEH). Researchers can implement these strategies to overcome these challenges:

  • Protein solubilization approaches:

    • Development of truncated constructs that retain catalytic activity but lack transmembrane domains

    • Use of detergents optimized for membrane protein extraction (e.g., CHAPS, digitonin, DDM)

    • Nanodiscs or liposome reconstitution to maintain native-like membrane environment

  • Expression system considerations:

    • Preference for eukaryotic expression systems that properly process membrane proteins

    • Codon optimization for the expression host

    • Use of fusion partners to enhance solubility and folding

  • Functional assays adaptation:

    • Development of assays that accommodate detergent presence

    • Solid-phase assays for membrane-anchored enzymes

    • Use of fluorogenic or chromogenic substrates compatible with membrane environments

  • Structural characterization strategies:

    • Cryo-electron microscopy for membrane proteins

    • X-ray crystallography of detergent-solubilized or truncated versions

    • Computational modeling based on homologous proteins with known structures

  • In vivo functional assessment:

    • Transgenic approaches with tissue-specific expression

    • Development of conditional knockout models

    • Use of membrane-permeable activity-based protein profiling probes

What insights can be gained from studying EPHX3 across different species regarding its evolutionary conservation and divergence?

Studying EPHX3 across different species provides valuable insights into both conservation and divergence of function:

  • Conservation of catalytic mechanism: The epoxide hydrolase catalytic mechanism is likely conserved across species, suggesting fundamental importance of this enzymatic activity throughout evolution.

  • Divergence in substrate specificity: The specialized role of mammalian EPHX3 in hydrolyzing esterified epoxyalcohols in skin ceramides may represent adaptive specialization not present in all species.

  • Tissue expression patterns: Variations in tissue expression across species may reflect adaptation to different physiological needs. In mammals, EPHX3 is highly expressed in tissues with barrier functions (skin, digestive tract) .

  • Functional redundancy: Studies in mice reveal that despite efficient in vitro hydrolysis of EpOMEs by EPHX3, this function appears redundant in vivo, with EPHX1 and EPHX2 compensating for EPHX3 deficiency in EpOME metabolism . This suggests evolutionary development of backup systems for critical metabolic functions.

  • Specialized functions: The emergence of specialized functions, such as EPHX3's role in skin barrier formation in mammals, represents evolutionary adaptation to terrestrial environments where water conservation is critical.

Comparative genomic approaches, including analysis of EPHX3 homologs across diverse species (from sea urchin to mammals), can provide further insights into how this enzyme family evolved to serve both conserved metabolic functions and species-specific adaptations .

How do the roles of EPHX3 in lipid metabolism compare between amphibian and mammalian systems?

The comparative analysis of EPHX3's role in lipid metabolism between amphibian and mammalian systems reveals:

  • Substrate metabolism differences:

    • Mammalian EPHX3 shows specialized activity toward linoleate-derived epoxides, particularly those esterified in acylceramides

    • The specific substrate preferences of Xenopus tropicalis EPHX3 are not well characterized in the search results

  • Involvement in barrier function:

    • Mammalian EPHX3 plays a role in the formation of the epidermal permeability barrier through ceramide metabolism

    • The role of Xenopus EPHX3 in amphibian skin barrier function remains to be elucidated

  • Metabolic pathways:

    • In mammals, EPHX3 functions within the 12R-lipoxygenase (12R-LOX)/eLOX3 pathway in epidermis, potentially controlling flux through the dehydrogenation pathway of SDR9C7

    • The integration of EPHX3 into amphibian lipid metabolism pathways requires further investigation

  • Physiological context:

    • Mammals and amphibians face different challenges in water conservation and barrier function, likely influencing the evolutionary adaptation of EPHX3

    • Amphibian skin serves both respiratory and barrier functions, potentially requiring different lipid metabolism regulation

  • Developmental roles:

    • The developmental expression and function of EPHX3 during metamorphosis in amphibians could provide unique insights not available in mammalian systems

Further comparative research between amphibian and mammalian EPHX3 could elucidate how this enzyme adapted to serve species-specific metabolic needs while maintaining core catalytic functions.

What are the most promising approaches for developing specific inhibitors or modulators of EPHX3 activity?

Several promising strategies exist for developing specific EPHX3 inhibitors or modulators:

  • Structure-based drug design:

    • Determination of crystal structure of EPHX3 catalytic domain

    • In silico screening of compound libraries against the active site

    • Rational design of transition-state analogs specific to EPHX3's catalytic mechanism

  • High-throughput screening approaches:

    • Development of fluorescence-based activity assays suitable for screening

    • Fragment-based drug discovery to identify initial binding scaffolds

    • Phenotypic screening using cell lines with EPHX3-dependent functions

  • Substrate-inspired design:

    • Creation of substrate mimics based on the epoxyalcohol structure preferred by EPHX3

    • Development of suicide inhibitors that form covalent bonds with the catalytic site

    • Exploration of acylceramide-linked compounds to target EPHX3's preference for esterified substrates

  • Differential targeting strategies:

    • Exploitation of differences between EPHX3 and other epoxide hydrolases (EPHX1, EPHX2)

    • Design of allosteric modulators targeting non-catalytic regions unique to EPHX3

    • Membrane-targeted compounds that concentrate near the enzyme's cellular location

  • Therapeutic development considerations:

    • Assessment of tissue-specific delivery systems, particularly for skin conditions

    • Evaluation of safety profiles given EPHX3's role in barrier function

    • Investigation of potential applications in conditions with altered skin barrier function

What experimental approaches would best elucidate the potential roles of EPHX3 beyond skin barrier function?

To explore EPHX3 functions beyond skin barrier regulation, researchers should consider these experimental approaches:

  • Comprehensive tissue expression analysis:

    • Single-cell RNA sequencing across tissues with known EPHX3 expression (digestive tract, bone marrow, lymphoid tissues)

    • Protein localization studies using specific antibodies against EPHX3

    • Developmental expression profiling to identify temporal regulation

  • Specialized knockout models:

    • Tissue-specific conditional knockout mice to avoid skin phenotype complications

    • Inducible knockout systems for temporal control of EPHX3 deletion

    • Examination of phenotypes in tissues beyond skin, particularly in immunological and digestive systems

  • Substrate identification studies:

    • Untargeted lipidomics to identify altered lipid profiles in EPHX3-deficient tissues

    • Activity-based protein profiling to identify physiological substrates in different tissues

    • In vitro screening of complex lipid substrates beyond linoleate derivatives

  • Functional studies in disease models:

    • Investigation of EPHX3's role in inflammatory conditions

    • Assessment of EPHX3 function in models of digestive tract disorders

    • Evaluation of potential immunological phenotypes, given expression in lymphoid tissues

  • Interactome analysis:

    • Identification of protein-protein interactions specific to different tissues

    • Characterization of potential protein complexes containing EPHX3

    • Investigation of regulatory mechanisms controlling EPHX3 activity in different cellular contexts

How might the study of Xenopus tropicalis EPHX3 contribute to understanding human skin disorders associated with barrier dysfunction?

Xenopus tropicalis EPHX3 research offers several potential contributions to understanding human skin disorders:

  • Evolutionary insights into barrier formation:

    • Comparative analysis of amphibian and mammalian skin barrier development

    • Identification of conserved molecular mechanisms in barrier formation

    • Understanding how EPHX3 function adapted during the evolution of terrestrial life

  • Developmental biology perspectives:

    • Study of EPHX3's role during amphibian metamorphosis and skin remodeling

    • Investigation of regulatory networks controlling EPHX3 expression during development

    • Potential identification of novel factors influencing barrier formation applicable to human conditions

  • Experimental advantages of the Xenopus system:

    • Amenability to genetic manipulation through CRISPR/Cas9 or morpholinos

    • External embryonic development allowing direct observation of skin formation

    • Potential for high-throughput screening of compounds affecting EPHX3 function

  • Therapeutic target validation:

    • Testing of potential EPHX3 modulators in a physiologically relevant non-mammalian system

    • Complementary model for validating findings from mouse and human studies

    • Identification of conserved pathways that might be targeted therapeutically

  • Translational implications:

    • Insights into fundamental mechanisms of barrier formation relevant to human conditions like ichthyosis

    • Understanding of EPHX3's role in lipid metabolism that may inform treatment approaches

    • Potential identification of biomarkers for skin barrier dysfunction based on conserved EPHX3 pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.